GlyCosmos Portal

Submissions

Histone-binding protein RBBP4

Summary

UniProt ID: Q60972
Gene Symbol: Rbap48 Rbbp4
Gene ID: 19646
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q60972
PubChem: Q60972
Re-Glyco: Q60972

Annotation

Keyword: Acetylation Cell cycle Chaperone Chromatin regulator DNA repair DNA replication Isopeptide bond Nucleus Phosphoprotein Reference proteome Repeat Repressor Telomere Transcription regulation Ubl conjugation WD repeat

Gene Ontology (GO)

Displaying entries **1 - 5** of 26 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	NAS	PMID PMID
DNA replication
DNA repair
nucleosome assembly
DNA replication-dependent chromatin assembly	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

DNA replication-dependent chromatin assembly

chromatin remodeling

nucleosome organization [inference]

nucleosome assembly

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

nucleosome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

nucleosome assembly

protein-DNA complex organization [inference]

nucleosome organization [inference]

nucleosome assembly

protein-DNA complex assembly [inference]

nucleosome assembly

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

brain development

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of developmental process [inference]

positive regulation of stem cell population maintenance

positive regulation of multicellular organismal process [inference]

positive regulation of stem cell population maintenance

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of developmental process [inference]

negative regulation of stem cell population maintenance

negative regulation of multicellular organismal process [inference]

negative regulation of stem cell population maintenance

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of cellular response to transforming growth factor beta stimulus [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of developmental process [inference]

regulation of cell fate commitment [inference]

regulation of cell fate specification

regulation of cell differentiation [inference]

regulation of stem cell differentiation

negative regulation of developmental process [inference]

negative regulation of stem cell population maintenance

positive regulation of developmental process [inference]

positive regulation of stem cell population maintenance

regulation of stem cell population maintenance [inference]

regulation of cellular process [inference]

regulation of cell fate commitment [inference]

regulation of cell fate specification

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cell differentiation [inference]

regulation of stem cell differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of transforming growth factor beta receptor signaling pathway

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of stem cell population maintenance

negative regulation of multicellular organismal process [inference]

negative regulation of stem cell population maintenance

regulation of stem cell population maintenance [inference]

Displaying entries **1 - 5** of 34 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
histone deacetylase complex	ISO	GO_REF
histone deacetylase complex	IEA	GO_REF
chromosome, telomeric region	ISO	GO_REF
chromosome, telomeric region	IEA	GO_REF GO_REF
chromatin	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

transcription regulator complex [inference]

NuRD complex

CAF-1 complex

nuclear protein-containing complex [inference]

histone deacetylase complex

PcG protein complex [inference]

ESC/E(Z) complex

histone methyltransferase complex [inference]

ESC/E(Z) complex

SWI/SNF superfamily-type complex [inference]

ISWI-type complex [inference]

NURF complex

CHD-type complex [inference]

NuRD complex

catalytic complex [inference]

histone deacetylase complex

ATPase complex

SWI/SNF superfamily-type complex [inference]

ISWI-type complex [inference]

NURF complex

CHD-type complex [inference]

NuRD complex

transferase complex [inference]

methyltransferase complex [inference]

histone methyltransferase complex [inference]

ESC/E(Z) complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

chromosomal region [inference]

chromosome, telomeric region

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	PMID
ATP-dependent activity, acting on DNA	ISS	GO_REF
ATP-dependent activity, acting on DNA	ISO	GO_REF
ATP-dependent activity, acting on DNA	IEA	GO_REF
histone binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

catalytic activity, acting on a nucleic acid [inference]

catalytic activity, acting on DNA [inference]

ATP-dependent activity, acting on DNA

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

protein binding [inference]

enzyme binding [inference]

histone deacetylase binding

histone binding

ATP-dependent activity [inference]

ATP-dependent activity, acting on DNA

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
329			G63976XX	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 14 in total

1

2

Next ›

Last »
Pathway Name	Organism
Deposition of new CENPA-containing nucleosomes at the centromere	Mus musculus
G0 and Early G1	Mus musculus
HDACs deacetylate histones	Mus musculus
Interaction of NuRD complexes with transcription factors	Mus musculus
Negative Regulation of CDH1 Gene Transcription	Mus musculus
NuRD complex assembly	Mus musculus
Oxidative Stress Induced Senescence	Mus musculus
PKMTs methylate histone lysines	Mus musculus
PRC2 methylates histones and DNA	Mus musculus
RNA Polymerase I Transcription Initiation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements