GlyCosmos Portal

Submissions

Serine/threonine-protein kinase PAK 3

Summary

UniProt ID

Q61036

Gene Symbol

Pak-3
Pak3
Pakb
Stk4

Gene ID

[18481]

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005445
PubChem: Q61036
Re-Glyco: Q61036

Annotation

Keyword: 3D-structure ATP-binding Allosteric enzyme Alternative splicing Cytoplasm Developmental protein Magnesium Metal-binding Phosphoprotein Reference proteome SH3-binding Serine/threonine-protein kinase Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
axonogenesis	IMP	PMID
cellular response to starvation	IBA	GO_REF
positive regulation of fibroblast migration	ISO	GO_REF
regulation of neuron projection development	ISO	GO_REF
dendrite development	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction

cell motility [inference]

cell migration

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

cellular response to stress [inference]

cellular response to starvation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection organization [inference]

dendritic spine organization [inference]

dendritic spine morphogenesis

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

postsynapse organization [inference]

dendritic spine organization [inference]

dendritic spine morphogenesis

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

anatomical structure development [inference]

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

cellular response to starvation

response to starvation [inference]

cellular response to starvation

response to nutrient levels [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

response to starvation [inference]

cellular response to starvation

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

cellular response to stress [inference]

cellular response to starvation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration [inference]

positive regulation of fibroblast migration

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of dendritic spine development [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of dendrite morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of axonogenesis

regulation of dendritic spine morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of dendrite development [inference]

regulation of dendrite morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of dendritic spine development [inference]

positive regulation of dendritic spine morphogenesis

regulation of dendritic spine development [inference]

positive regulation of dendritic spine development [inference]

positive regulation of dendritic spine morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

regulation of protein polymerization [inference]

regulation of actin filament polymerization

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development

positive regulation of neuron projection development [inference]

positive regulation of dendritic spine morphogenesis

regulation of axonogenesis

regulation of dendrite development [inference]

regulation of dendrite morphogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of dendritic spine morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of protein-containing complex assembly [inference]

regulation of protein polymerization [inference]

regulation of actin filament polymerization

regulation of synapse organization [inference]

regulation of postsynapse organization

regulation of dendritic spine morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration [inference]

positive regulation of fibroblast migration

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of fibroblast migration

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis [inference]

positive regulation of dendritic spine morphogenesis

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF
endosome	ISO	GO_REF
cytosol	TAS	Reactome
postsynaptic density	IEP	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

synapse [inference]

glutamatergic synapse

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein kinase activity	ISO	GO_REF
protein kinase activity	IDA	PMID
protein kinase activity	IEA	GO_REF
protein serine/threonine kinase activity	ISO	GO_REF GO_REF
protein serine/threonine kinase activity	TAS	Reactome

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein serine kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein serine kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein serine kinase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

GTPase binding

small GTPase binding

protein domain specific binding [inference]

SH3 domain binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSDSLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHQSNTKTASEPPLAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEDIPPSAENANSTTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
121				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 10** entries
Pathway Name	Organism
CD209 (DC-SIGN) signaling	Mus musculus
CD28 dependent Vav1 pathway	Mus musculus
Ephrin signaling	Mus musculus
Generation of second messenger molecules	Mus musculus
MAPK6/MAPK4 signaling	Mus musculus
RAC1 GTPase cycle	Mus musculus
RHO GTPases activate PAKs	Mus musculus
RHOU GTPase cycle	Mus musculus
Sema3A PAK dependent Axon repulsion	Mus musculus
VEGFR2 mediated vascular permeability	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements