GlyCosmos Portal

Submissions

Macrophage metalloelastase

Summary

UniProt ID

Q63341

Gene Symbol

Mmel
Mmp12

Gene ID

[117033]

Organism

Rattus norvegicus (Norway rat)

External Links

PubChem: Q63341
Re-Glyco: Q63341

Annotation

Keyword: Calcium Disulfide bond Extracellular matrix Glycoprotein Metal-binding Metalloprotease Reference proteome Repeat Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	ISO	GO_REF
response to hypoxia	IEP	PMID
proteolysis	ISO	GO_REF
proteolysis	IEA	GO_REF
protein import into nucleus	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

collagen catabolic process

carbohydrate derivative catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

collagen metabolic process [inference]

collagen catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

protein metabolic process [inference]

proteolysis

glycoprotein metabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

elastin metabolic process [inference]

elastin catabolic process

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

glycoprotein metabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

elastin metabolic process [inference]

elastin catabolic process

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

elastin metabolic process [inference]

elastin catabolic process

carbohydrate derivative catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

cell motility [inference]

cell migration [inference]

wound healing, spreading of cells [inference]

wound healing, spreading of epidermal cells

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

developmental process [inference]

anatomical structure development [inference]

tube development [inference]

respiratory tube development [inference]

bronchiole development

lung alveolus development

animal organ development [inference]

respiratory tube development [inference]

bronchiole development

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

cellular response to virus

response to stimulus [inference]

response to stress [inference]

response to hypoxia

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

cellular response to virus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

cellular response to virus

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

response to chemical [inference]

response to xenobiotic stimulus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

protein localization to organelle [inference]

protein localization to nucleus [inference]

protein import into nucleus

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

establishment of protein localization to organelle [inference]

protein import into nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of immune response [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of trophoblast cell migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of epithelial cell proliferation involved in wound healing

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of response to cytokine stimulus [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion [inference]

negative regulation of cell-matrix adhesion [inference]

negative regulation of endothelial cell-matrix adhesion

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

regulation of defense response to virus [inference]

regulation of defense response to virus by host

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

regulation of defense response to virus [inference]

regulation of defense response to virus by host

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

positive regulation of response to cytokine stimulus [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of immune response [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

positive regulation of response to cytokine stimulus [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of innate immune response [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

regulation of defense response to virus [inference]

regulation of defense response to virus by host

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

regulation of type I interferon-mediated signaling pathway [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

regulation of type I interferon production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

regulation of interferon-alpha production [inference]

positive regulation of interferon-alpha production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

regulation of type I interferon production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

regulation of interferon-alpha production [inference]

positive regulation of interferon-alpha production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion [inference]

negative regulation of cell-matrix adhesion [inference]

negative regulation of endothelial cell-matrix adhesion

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

negative regulation of cell-matrix adhesion [inference]

negative regulation of endothelial cell-matrix adhesion

regulation of endothelial cell-matrix adhesion [inference]

negative regulation of endothelial cell-matrix adhesion

negative regulation of cell-substrate adhesion [inference]

negative regulation of cell-matrix adhesion [inference]

negative regulation of endothelial cell-matrix adhesion

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of epithelial cell proliferation involved in wound healing

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of epithelial cell proliferation involved in wound healing

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of epithelial cell proliferation involved in wound healing

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of cytokine-mediated signaling pathway [inference]

positive regulation of type I interferon-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion [inference]

negative regulation of cell-matrix adhesion [inference]

negative regulation of endothelial cell-matrix adhesion

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of type I interferon-mediated signaling pathway

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of trophoblast cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

regulation of type I interferon production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

regulation of interferon-alpha production [inference]

positive regulation of interferon-alpha production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production [inference]

positive regulation of interferon-alpha production

Displaying **all 4** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleus	ISO	GO_REF
cytoplasm	ISO	GO_REF
extracellular matrix	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

external encapsulating structure [inference]

extracellular matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
core promoter sequence-specific DNA binding	ISO	GO_REF
metalloendopeptidase activity	ISO	GO_REF
metalloendopeptidase activity	IEA	GO_REF GO_REF
calcium ion binding	ISO	GO_REF
collagen binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity

endopeptidase activity [inference]

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity

endopeptidase activity [inference]

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

core promoter sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

core promoter sequence-specific DNA binding

sequence-specific DNA binding

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

core promoter sequence-specific DNA binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

transition metal ion binding [inference]

zinc ion binding

protein-containing complex binding [inference]

collagen binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKFLLVLVLLVSLQVSACGAAPMNESEFAEWYLSRFFDYQGDRIPMTKTKTNRNLLEEKLQEMQQFFGLEVTGQLDTSTLKIMHTSRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKRADVDYIFQKAFQVWSDVTPLRFRKIHKGEADITILFAFGDHGDFYDFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLRHSNNPKSIMYPTYRYLHPNTFRLSADDIHSIQSLYGAPVKNPSLTNPGSPPSTVCHQSLSFDAVTTVGDKIFFFKDWFFWWRLPGSPATNITSISSMWPTIPSGIQAAYEIGGRNQLFLFKDEKYWLINNLVPEPHYPRSIHSLGFPASVKKIDAAVFDPLRQKVYFFVDKQYWRYDVRQELMDAAYPKLISTHFPGIRPKIDAVLYFKRHYYIFQGAYQLEYDPLLDRVTKTLSSTSWFGC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
313	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Collagen degradation	Rattus norvegicus
Degradation of the extracellular matrix	Rattus norvegicus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:13139	crescentic glomerulonephritis	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements