GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial

Summary

UniProt ID: Q68FX0
Gene Symbol: Idh3B
Gene ID: 94173
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: Q68FX0
PubChem: Q68FX0
The O-GlcNAc Database: Q68FX0
O-GlcNAcAtlas: Q68FX0
Re-Glyco: Q68FX0

Annotation

Keyword: Acetylation Mitochondrion Reference proteome Transit peptide Tricarboxylic acid cycle

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
tricarboxylic acid cycle	ISO	GO_REF
tricarboxylic acid cycle	IBA	GO_REF
tricarboxylic acid cycle	IEA	GO_REF GO_REF
isocitrate metabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

primary metabolic process [inference]

tricarboxylic acid cycle

small molecule metabolic process [inference]

alcohol metabolic process [inference]

secondary alcohol metabolic process [inference]

isocitrate metabolic process

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

tricarboxylic acid metabolic process [inference]

isocitrate metabolic process

Displaying **all 5** entries
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	NAS	PMID
mitochondrion	IBA	GO_REF
mitochondrion	IEA	GO_REF
isocitrate dehydrogenase complex (NAD+)	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

catalytic complex [inference]

tricarboxylic acid cycle heteromeric enzyme complex [inference]

isocitrate dehydrogenase complex (NAD+)

oxidoreductase complex [inference]

isocitrate dehydrogenase complex (NAD+)

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying **all 4** entries
GO Term	Evidence Code	Reference
magnesium ion binding	IEA	GO_REF
enzyme activator activity	ISO	GO_REF
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	GO_REF
NAD binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

magnesium ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity

molecular function activator activity [inference]

enzyme activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAALSNVRWLTRAVLGARNSGAWRGLRTAASAQAASQSQAQDVRVEGAFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFKEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIYTPMEYKGELASYDMQLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLHPHGG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
343		27213235	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Citric acid cycle (TCA cycle)	Rattus norvegicus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026