GlyCosmos Portal

Submissions

Zinc transporter ZIP5

Summary

UniProt ID: Q6ZMH5
Gene Symbol: SLC39A5 ZIP5
Gene ID: 283375
Organism: Homo sapiens (human)

External Links

GlyGen: Q6ZMH5
PubChem: Q6ZMH5
The Human Metabolome Database: HMDBP11938
Re-Glyco: Q6ZMH5

Annotation

Keyword: 3D-structure Cell membrane Disease variant Glycoprotein Methylation Phosphoprotein Proteomics identification Reference proteome Signal Transmembrane helix Zinc transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
eye development	IMP	PMID
zinc ion transport	ISS	GO_REF
zinc ion transport	IEA	GO_REF
intracellular monoatomic cation homeostasis	IBA	GO_REF
BMP signaling pathway	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cell population proliferation [inference]

neural precursor cell proliferation

cell cycle process [inference]

G1 to G0 transition [inference]

G1 to G0 transition involved in cell differentiation

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

cellular response to stress [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

zinc ion transmembrane transport

zinc ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

zinc ion import across plasma membrane

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

sensory organ development [inference]

eye development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

response to starvation [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

response to metal ion starvation [inference]

response to zinc ion starvation [inference]

cellular response to zinc ion starvation

response to nutrient levels [inference]

cellular response to nutrient levels [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

response to starvation [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

response to metal ion starvation [inference]

response to zinc ion starvation [inference]

cellular response to zinc ion starvation

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

cellular response to stress [inference]

cellular response to starvation [inference]

cellular response to zinc ion starvation

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

transition metal ion transport [inference]

zinc ion transport

zinc ion transmembrane transport

zinc ion import across plasma membrane

monoatomic cation transmembrane transport [inference]

zinc ion transmembrane transport

zinc ion import across plasma membrane

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

zinc ion transmembrane transport

zinc ion import across plasma membrane

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

zinc ion transmembrane transport

zinc ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

zinc ion import across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

zinc ion import across plasma membrane

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of RNA splicing [inference]

positive regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA processing [inference]

positive regulation of mRNA splicing, via spliceosome

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF
basolateral plasma membrane	ISS	GO_REF
basolateral plasma membrane	IEA	GO_REF GO_REF
extracellular exosome	HDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

basolateral plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying **all 4** entries
GO Term	Evidence Code	Reference
zinc ion transmembrane transporter activity	ISS	GO_REF
zinc ion transmembrane transporter activity	IBA	GO_REF
zinc ion transmembrane transporter activity	IEA	GO_REF
monoatomic cation:bicarbonate symporter activity	IBA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

solute:monoatomic cation symporter activity [inference]

monoatomic cation:bicarbonate symporter activity

metal ion transmembrane transporter activity [inference]

transition metal ion transmembrane transporter activity [inference]

zinc ion transmembrane transporter activity

bicarbonate transmembrane transporter activity [inference]

monoatomic cation:bicarbonate symporter activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

monoatomic cation:bicarbonate symporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
50	N-linked (GlcNAc...) asparagine			UniProt GlyGen
123		30459171	G29068FM	GlyGen
131		23584533	G57321FI	GlyGen
135		23584533	G57321FI	GlyGen
160	N-linked (GlcNAc...) asparagine			UniProt GlyGen
334		37074911	G47950XN G31852PQ G36379GD	GlyGen