GlyCosmos Portal

Submissions

Fatty acid 2-hydroxylase

Summary

UniProt ID: Q7L5A8
Gene Symbol: FA2H FAAH FAXDC1
Gene ID: 79152
Organism: Homo sapiens (human)

External Links

PubChem

Q7L5A8

SwissLipids

The Human Metabolome Database

HMDBP08645

The O-GlcNAc Database

Q7L5A8

Re-Glyco

Q7L5A8

Annotation

Keyword: Alternative splicing Disease variant Fatty acid biosynthesis Heme Hereditary spastic paraplegia Leukodystrophy Microsome Oxidoreductase Proteomics identification Reference proteome Sphingolipid metabolism Transmembrane helix Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
sebaceous gland cell differentiation
fatty acid metabolic process	IEA	GO_REF
fatty acid biosynthetic process
glucosylceramide biosynthetic process	ISS	GO_REF
glucosylceramide biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

ceramide biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process

fatty acid biosynthetic process

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

glycosylceramide metabolic process [inference]

glucosylceramide metabolic process [inference]

glucosylceramide biosynthetic process

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

ceramide biosynthetic process

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

glucosylceramide metabolic process [inference]

glucosylceramide biosynthetic process

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process [inference]

sphingolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

ceramide biosynthetic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

ceramide biosynthetic process

lipid modification

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

glucosylceramide metabolic process [inference]

glucosylceramide biosynthetic process

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process

fatty acid biosynthetic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carbohydrate derivative metabolic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

glucosylceramide metabolic process [inference]

glucosylceramide biosynthetic process

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epidermal cell differentiation [inference]

sebaceous gland cell differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

membrane organization [inference]

plasma membrane organization [inference]

myelin maintenance [inference]

membrane raft organization [inference]

plasma membrane raft organization

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

epidermis development [inference]

skin epidermis development [inference]

establishment of skin barrier

epithelium development [inference]

skin epidermis development [inference]

establishment of skin barrier

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epidermal cell differentiation [inference]

sebaceous gland cell differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

regulation of epithelial cell proliferation [inference]

regulation of multicellular organismal process [inference]

regulation of hair cycle

Displaying **all 5** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum	IEA	GO_REF
endoplasmic reticulum membrane	TAS	Reactome
endoplasmic reticulum membrane	IEA	GO_REF
membrane	IDA	PMID
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
iron ion binding
heme binding	IEA	GO_REF
fatty acid 2-hydroxylase activity	TAS	Reactome
fatty acid 2-hydroxylase activity	IDA	PMID PMID PMID
fatty acid 2-hydroxylase activity	IMP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

monooxygenase activity [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen [inference]

fatty acid 2-hydroxylase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen [inference]

fatty acid 2-hydroxylase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

iron ion binding

tetrapyrrole binding [inference]

heme binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites