GlyCosmos Portal

Annotation

Keyword: 3D-structure Adaptive immunity Alternative splicing Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Phosphoprotein Receptor Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
adaptive immune response
immune response-regulating cell surface receptor signaling pathway	IMP	PMID
immune response-regulating cell surface receptor signaling pathway	IBA	GO_REF
immune response-regulating cell surface receptor signaling pathway	IEA	GO_REF
cell surface receptor signaling pathway	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

adaptive immune response

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

cell surface receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway

response to stimulus [inference]

immune response [inference]

adaptive immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of response to stimulus [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

cell surface receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of alpha-beta T cell proliferation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

negative regulation of B cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of B cell proliferation

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of alpha-beta T cell proliferation

negative regulation of alpha-beta T cell activation [inference]

negative regulation of alpha-beta T cell proliferation

negative regulation of B cell activation [inference]

negative regulation of B cell proliferation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
plasma membrane	TAS	Reactome
plasma membrane	IDA	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
signaling receptor activity	ISO	GO_REF
signaling receptor activity	IGI	PMID
signaling receptor activity	IBA	GO_REF
signaling receptor activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKTVPAMLGTPRLFREFFILHLGLWSILCEKATKRNDEECPVQLTITRNSKQSARTGELFKIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLITVSDIPDATNASGPSTMEERPGRTWLLYTLLPLGALLLLLACVCLLCFLKRIQGKEKKPSDLAGRDTNLVDIPASSRTNHQALPSGTGIYDNDPWSSMQDESELTISLQSERNNQGIVYASLNHCVIGRNPRQENNMQEAPTEYASICVRS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
74	N-linked (GlcNAc...) asparagine	UniProt
81	N-linked (GlcNAc...) asparagine	UniProt
101	N-linked (GlcNAc...) asparagine	UniProt
119	N-linked (GlcNAc...) asparagine	UniProt
148	N-linked (GlcNAc...) asparagine	UniProt
165	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Co-inhibition by BTLA	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements