GlyCosmos Portal

Submissions

Heparan sulfate glucosamine 3-O-sulfotransferase 5

Summary

UniProt ID: Q8IZT8
Gene Symbol: HS3ST5 3OST5 HS3OST5
Gene ID: 222537
Organism: Homo sapiens (human)

External Links

The Human Metabolome Database: HMDBP00351
Re-Glyco: Q8IZT8

Annotation

Keyword: 3D-structure Disulfide bond Glycoprotein Golgi apparatus Proteomics identification Reference proteome Signal-anchor Transferase Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
protein sulfation
heparan sulfate proteoglycan biosynthetic process	TAS	Reactome
heparan sulfate proteoglycan biosynthetic process	IDA	PMID PMID
regulation of viral entry into host cell	IDA	PMID
negative regulation of coagulation	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

sulfation [inference]

protein sulfation

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

heparan sulfate proteoglycan metabolic process [inference]

heparan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

protein modification process [inference]

protein sulfation

macromolecule modification [inference]

protein modification process [inference]

protein sulfation

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

heparan sulfate proteoglycan metabolic process [inference]

heparan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

protein modification process [inference]

protein sulfation

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

heparan sulfate proteoglycan metabolic process [inference]

heparan sulfate proteoglycan biosynthetic process

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation [inference]

protein O-linked glycosylation via xylose [inference]

heparan sulfate proteoglycan biosynthetic process

proteoglycan biosynthetic process [inference]

heparan sulfate proteoglycan biosynthetic process

biological regulation [inference]

regulation of biological process [inference]

regulation of biological process involved in symbiotic interaction [inference]

modulation by symbiont of entry into host [inference]

regulation of viral entry into host cell

negative regulation of biological process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation

regulation of viral process [inference]

regulation of viral life cycle [inference]

regulation of viral entry into host cell

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

negative regulation of coagulation

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation

Displaying **all 3** entries
GO Term	Evidence Code	Reference
Golgi membrane	TAS	Reactome
Golgi membrane	IEA	GO_REF
membrane	NAS	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
[heparan sulfate]-glucosamine 3-sulfotransferase activity	TAS	Reactome
[heparan sulfate]-glucosamine 3-sulfotransferase activity	IDA	PMID PMID PMID
[heparan sulfate]-glucosamine 3-sulfotransferase activity	IBA	GO_REF
[heparan sulfate]-glucosamine 3-sulfotransferase activity	IEA	GO_REF GO_REF
3'-phosphoadenosine 5'-phosphosulfate binding	NAS	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring sulphur-containing groups [inference]

sulfotransferase activity [inference]

proteoglycan sulfotransferase activity [inference]

heparan sulfate sulfotransferase activity [inference]

[heparan sulfate]-glucosamine 3-sulfotransferase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

sulfur compound binding [inference]

3'-phosphoadenosine 5'-phosphosulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLFKQQAWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYGKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites