GlyCosmos Portal

Submissions

Cytoplasmic dynein 1 light intermediate chain 1

Summary

UniProt ID: Q8R1Q8
Gene Symbol: Dync1li1 Dncli1 Dnclic1
Gene ID: 235661
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q8R1Q8
The O-GlcNAc Database: Q8R1Q8
RaftProt: Q8R1Q8
O-GlcNAcAtlas: Q8R1Q8
Re-Glyco: Q8R1Q8

Annotation

Keyword: ATP-binding Centromere Chromosome Cytoskeleton Direct protein sequencing Dynein Endosome Kinetochore Membrane Microtubule Mitosis Motor protein Phosphoprotein Reference proteome Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization	IBA	GO_REF
microtubule-based movement	ISS	PMID GO_REF
microtubule-based movement	ISO	GO_REF
microtubule-based movement	IBA	GO_REF
microtubule-based movement	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

cell division

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

response to stimulus [inference]

response to endogenous stimulus [inference]

response to growth factor [inference]

cellular response to growth factor stimulus [inference]

cellular response to nerve growth factor stimulus

response to nerve growth factor [inference]

cellular response to nerve growth factor stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus [inference]

cellular response to nerve growth factor stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of intracellular signal transduction [inference]

regulation of cell cycle checkpoint [inference]

regulation of spindle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic spindle checkpoint [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of localization [inference]

regulation of transport [inference]

regulation of vesicle-mediated transport

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of intracellular signal transduction [inference]

regulation of cell cycle checkpoint [inference]

regulation of spindle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic spindle checkpoint [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of intracellular signal transduction [inference]

regulation of cell cycle checkpoint [inference]

regulation of spindle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic spindle checkpoint [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of microtubule-based process [inference]

regulation of centrosome cycle

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of chromosome organization [inference]

regulation of sister chromatid segregation [inference]

regulation of mitotic sister chromatid segregation [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of metaphase/anaphase transition of cell cycle [inference]

regulation of mitotic metaphase/anaphase transition [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of nuclear division [inference]

regulation of mitotic nuclear division [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of centrosome cycle

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic cell cycle phase transition [inference]

regulation of mitotic metaphase/anaphase transition [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic spindle checkpoint [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of cell cycle process [inference]

regulation of mitotic nuclear division [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of centrosome cycle

regulation of chromosome segregation [inference]

regulation of sister chromatid segregation [inference]

regulation of mitotic sister chromatid segregation [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of metaphase/anaphase transition of cell cycle [inference]

regulation of mitotic metaphase/anaphase transition [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of chromosome separation [inference]

regulation of mitotic sister chromatid separation [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle process [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of cell cycle phase transition [inference]

regulation of cell cycle checkpoint [inference]

regulation of spindle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic spindle checkpoint [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle checkpoint [inference]

positive regulation of spindle checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of mitotic cell cycle phase transition [inference]

regulation of mitotic metaphase/anaphase transition [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of metaphase/anaphase transition of cell cycle [inference]

regulation of mitotic metaphase/anaphase transition [inference]

regulation of mitotic cell cycle spindle assembly checkpoint [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic cell cycle spindle assembly checkpoint

regulation of vesicle-mediated transport

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
kinetochore	ISS	GO_REF
kinetochore	ISO	GO_REF GO_REF
kinetochore	IEA	GO_REF
spindle pole	ISS	GO_REF
spindle pole	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

microtubule associated complex [inference]

dynein complex [inference]

cytoplasmic dynein complex

catalytic complex [inference]

dynein complex [inference]

cytoplasmic dynein complex

cellular anatomical structure [inference]

spindle pole

microtubule organizing center [inference]

centrosome

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

recycling endosome membrane

endocytic vesicle membrane

bounding membrane of organelle [inference]

endosome membrane [inference]

recycling endosome membrane

endocytic vesicle membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

kinetochore

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

intracellular membraneless organelle [inference]

kinetochore

supramolecular complex [inference]

kinetochore

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

microtubule

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule motor activity	ISS	PMID
ATP binding
GDP binding	ISO	GO_REF
GDP binding	IEA	GO_REF
protein-macromolecule adaptor activity	ISO	GO_REF

GO Hierarchy

molecular function

cytoskeletal motor activity [inference]

microtubule motor activity

catalytic activity [inference]

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

polypeptide conformation or assembly isomerase activity [inference]

microtubule motor activity

binding [inference]

protein binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GDP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GDP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GDP binding

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GDP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

guanyl ribonucleotide binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular adaptor activity

protein-macromolecule adaptor activity

ATP-dependent activity [inference]

microtubule motor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAVGRVGSFGSSPPGLASTYASGPLANELASGSGGPAAGDDEDGQNLWSCILSEVSTRSRSKLPTGKNVLLLGEDGAGKTSLIRRIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDALSLRDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKEMEQKLIRDFQEYVEPGEDFPASPQRRTTGAQEDRGDSVVLPLGADTLTHNLGLPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKVEDNFEDIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVGGSPGGGAAGASPSLPPSAKKSGQKPVLSDVHAELDRITRKPASVSPTTPTSPTEGEAS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
412		22645316 28135057 33300544 35822049 36288343 36852467 40885482	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 12 in total

1

2

Next ›

Last »
Pathway Name	Organism
Aggrephagy	Mus musculus
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal	Mus musculus
COPI-independent Golgi-to-ER retrograde traffic	Mus musculus
COPI-mediated anterograde transport	Mus musculus
EML4 and NUDC in mitotic spindle formation	Mus musculus
HSP90 chaperone cycle for SHRs	Mus musculus
MHC class II antigen presentation	Mus musculus
Mitotic Prometaphase	Mus musculus
Neutrophil degranulation	Mus musculus
RHO GTPases Activate Formins	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements