GlyCosmos Portal

Submissions

Carboxylesterase 1D

Summary

UniProt ID: Q8VCT4
Gene Symbol: Ces1d Ces1 Ces3
Gene ID: 104158
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0006964
GlyGen: Q8VCT4
PubChem: Q8VCT4
RaftProt: Q8VCT4
Re-Glyco: Q8VCT4

Annotation

Keyword: Cytoplasm Direct protein sequencing Disulfide bond Glycoprotein Lipid degradation Lipid droplet Microsome Reference proteome Serine esterase Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
acyl-CoA metabolic process	TAS	PMID
response to toxic substance	TAS	PMID
lipid catabolic process	NAS	PMID
lipid catabolic process	IDA	PMID
short-chain fatty acid catabolic process	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

acyl-CoA metabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process

catabolic process [inference]

lipid catabolic process

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process

cytosolic lipolysis

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process

lipid metabolic process [inference]

fatty acid metabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

short-chain fatty acid metabolic process [inference]

short-chain fatty acid catabolic process

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

acylglycerol catabolic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process

lipid catabolic process

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process

cytosolic lipolysis

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

acylglycerol catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

short-chain fatty acid metabolic process [inference]

short-chain fatty acid catabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

short-chain fatty acid catabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process

purine-containing compound metabolic process [inference]

acyl-CoA metabolic process

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to cold

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

very-low-density lipoprotein particle assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

very-low-density lipoprotein particle assembly

protein-lipid complex organization [inference]

protein-lipid complex assembly [inference]

plasma lipoprotein particle assembly [inference]

very-low-density lipoprotein particle assembly

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle assembly [inference]

very-low-density lipoprotein particle assembly

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

circadian temperature homeostasis

adaptive thermogenesis [inference]

cold-induced thermogenesis

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle assembly [inference]

very-low-density lipoprotein particle assembly

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

circadian temperature homeostasis

adaptive thermogenesis [inference]

cold-induced thermogenesis

rhythmic process [inference]

circadian rhythm [inference]

circadian temperature homeostasis

response to stimulus [inference]

response to stress [inference]

response to cold [inference]

cellular response to cold

cellular response to stress [inference]

cellular response to cold

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to cold [inference]

cellular response to cold

response to chemical [inference]

response to toxic substance

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to cold

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	TAS	PMID
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

membraneless organelle [inference]

intracellular membraneless organelle [inference]

lipid droplet

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular membraneless organelle [inference]

lipid droplet

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
sterol ester esterase activity	ISO	GO_REF
sterol ester esterase activity	IDA	PMID
triacylglycerol lipase activity	IDA	PMID
fatty-acyl-ethyl-ester synthase activity	ISO	GO_REF
fatty-acyl-ethyl-ester synthase activity	EXP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

carboxylic ester hydrolase activity

retinyl-palmitate esterase activity

all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity

carboxylesterase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGLYPLIWLSLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHREHVEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
79	N-linked (GlcNAc...) asparagine		G59354CW	GlycoProtDB UniProt GlyGen
489	N-linked (GlcNAc...) asparagine		G18647XP	UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Aspirin ADME	Mus musculus
Metabolism of Angiotensinogen to Angiotensins	Mus musculus
Phase I - Functionalization of compounds	Mus musculus
Physiological factors	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements