GlyCosmos Portal

Submissions

Endothelial cell-selective adhesion molecule

Summary

UniProt ID: Q96AP7
Gene Symbol: ESAM UNQ220/PRO246
Gene ID: 90952
Organism: Homo sapiens (human)

External Links

GlyConnect

Endothelial cell-selective adhesion molecule

GlyGen

Q96AP7

RaftProt

Q96AP7

Re-Glyco

Q96AP7

Annotation

Keyword: Alternative splicing Cell adhesion Cell membrane Direct protein sequencing Disease variant Disulfide bond Glycoprotein Immunoglobulin domain Intellectual disability Phosphoprotein Proteomics identification Reference proteome Repeat Signal Tight junction Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
homophilic cell-cell adhesion	IBA	GO_REF
protein localization	IDA	PMID
intracellular protein localization	IDA	PMID
regulation of actin filament polymerization	IDA	PMID
regulation of actin cytoskeleton organization	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion

homophilic cell-cell adhesion

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

tight junction assembly [inference]

bicellular tight junction assembly

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

cell junction organization [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

tight junction assembly [inference]

bicellular tight junction assembly

cell-cell junction organization [inference]

cell-cell junction assembly [inference]

tight junction assembly [inference]

bicellular tight junction assembly

tight junction organization [inference]

tight junction assembly [inference]

bicellular tight junction assembly

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

maintenance of blood-brain barrier

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

maintenance of blood-brain barrier

localization [inference]

macromolecule localization [inference]

intracellular protein localization

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

regulation of protein polymerization [inference]

regulation of actin filament polymerization

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of protein-containing complex assembly [inference]

regulation of protein polymerization [inference]

regulation of actin filament polymerization

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	TAS	Reactome
plasma membrane	IDA	PMID PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
cell-cell junction	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction

adherens junction

tight junction [inference]

bicellular tight junction

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cell-cell adhesion mediator activity	IDA	PMID
cell-cell adhesion mediator activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cell adhesion molecule binding [inference]

cell adhesion mediator activity [inference]

cell-cell adhesion mediator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
108	N-linked (GlcNAc...) asparagine			UniProt GlyGen
169	N-linked (GlcNAc...) asparagine	19159218 23090970 24190977 29391424 37074911	G30221QT G57888GL G63980BQ G22310AV G08918WF G27058EU G84452RH G83460ZZ G70619PT G90659AW G59924QI G47644PP G05049YU G18647XP G85269DF G95865ZB G11314AS G02815KT	UniProt GlyGen GlyConnect
213	N-linked (GlcNAc...) asparagine	29391424 37074911	G57888GL G52527GH G81263BG G59536GA G41840AI G01650EU G47702MW G63041LO G59924QI G37399XV G47644PP G95865ZB G31852PQ	UniProt GlyGen GlyConnect
236	N-linked (GlcNAc...) asparagine			UniProt GlyGen
307		29391424	G33791AF	GlyGen GlyConnect
334				GlyGen