Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Histone acetyltransferase KAT2B
Summary
- UniProt ID
- Q9JHD1
- Gene Symbol
- Kat2b Pcaf
- Gene ID
- 18519
- Organism
- Mus musculus (house mouse)
Annotation
- Keyword
- 3D-structure Activator Acyltransferase Biological rhythms Bromodomain Cell cycle Cytoskeleton Nucleus Reference proteome Transcription regulation
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| negative regulation of transcription by RNA polymerase II | ||
| negative regulation of transcription by RNA polymerase II | ||
| positive regulation of transcription from RNA polymerase II promoter by glucose | ||
| gluconeogenesis |
|
|
| regulation of DNA repair |
GO Hierarchy
- rhythmic process
- regulation of RNA splicing
- regulation of cell division
biological process
cellular process [inference]
response to stimulus [inference]
response to nutrient levels [inference]
response to chemical [inference]
cellular response to stimulus [inference]
biological regulation [inference]
regulation of biological process [inference]
positive regulation of biological process [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
negative regulation of biological process [inference]
regulation of cellular process [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
positive regulation of biosynthetic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
positive regulation of macromolecule biosynthetic process [inference]
regulation of RNA biosynthetic process [inference]
negative regulation of metabolic process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
regulation of ketone metabolic process [inference]
regulation of phosphorus metabolic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
positive regulation of macromolecule biosynthetic process [inference]
regulation of RNA biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
negative regulation of macromolecule metabolic process [inference]
regulation of protein metabolic process [inference]
regulation of RNA metabolic process [inference]
positive regulation of RNA metabolic process [inference]
regulation of RNA biosynthetic process [inference]
regulation of small molecule metabolic process [inference]
regulation of primary metabolic process [inference]
regulation of lipid metabolic process [inference]
regulation of nucleobase-containing compound metabolic process [inference]
regulation of RNA metabolic process [inference]
positive regulation of RNA metabolic process [inference]
regulation of RNA biosynthetic process [inference]
regulation of protein metabolic process [inference]
positive regulation of cellular process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
negative regulation of cellular process [inference]
regulation of cellular component organization [inference]
regulation of cell cycle
regulation of molecular function [inference]
GO Hierarchy
| GO Term | Evidence Code | Reference |
|---|---|---|
| RNA polymerase II transcription regulatory region sequence-specific DNA binding | ||
| chromatin binding | ||
| chromatin binding | ||
| chromatin binding | ||
| transcription coregulator activity |
GO Hierarchy
Sequence
MAEAGGAGSPALPPAPPHGSPRTLATAAGSSASCGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSPLGIQTVISPPVTGTALFSSNSTSHEQINGGRTSPGCRGSSGLEANPGEKRKMNNSHAPEEAKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPKDPEQLYSTLKNILQQVKNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 101 |
|
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| B-WICH complex positively regulates rRNA expression | Mus musculus |
| Estrogen-dependent gene expression | Mus musculus |
| Formation of WDR5-containing histone-modifying complexes | Mus musculus |
| Metalloprotease DUBs | Mus musculus |
| NOTCH1 Intracellular Domain Regulates Transcription | Mus musculus |
| Notch-HLH transcription pathway | Mus musculus |
| RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function | Mus musculus |
| RUNX3 regulates NOTCH signaling | Mus musculus |
| Regulation of FOXO transcriptional activity by acetylation | Mus musculus |
| YAP1- and WWTR1 (TAZ)-stimulated gene expression | Mus musculus |
