GlyCosmos Portal

Submissions

Carboxypeptidase B2

Summary

UniProt ID: Q9JHH6
Gene Symbol: Cpb2 Tafi
Gene ID: 56373
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0007545
GlyGen: Q9JHH6
PubChem: Q9JHH6
Re-Glyco: Q9JHH6

Annotation

Keyword: Carboxypeptidase Disulfide bond Fibrinolysis Glycoprotein Metal-binding Metalloprotease Reference proteome Secreted Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of extracellular matrix constituent secretion	ISO	GO_REF
proteolysis	IBA	GO_REF
proteolysis	IEA	GO_REF
blood coagulation
negative regulation of plasminogen activation	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

primary metabolic process [inference]

protein metabolic process [inference]

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

regulation of secretion by cell [inference]

regulation of extracellular matrix constituent secretion [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation [inference]

negative regulation of plasminogen activation

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

regulation of hepatocyte proliferation [inference]

negative regulation of hepatocyte proliferation

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of hepatocyte proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein metabolic process [inference]

negative regulation of proteolysis [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

negative regulation of protein maturation [inference]

negative regulation of protein processing [inference]

negative regulation of plasminogen activation

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

regulation of extracellular matrix organization [inference]

regulation of extracellular matrix constituent secretion [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of extracellular matrix organization [inference]

positive regulation of extracellular matrix constituent secretion

regulation of secretion by cell [inference]

regulation of extracellular matrix constituent secretion [inference]

positive regulation of extracellular matrix constituent secretion

positive regulation of secretion by cell [inference]

positive regulation of extracellular matrix constituent secretion

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

regulation of biological quality [inference]

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

negative regulation of blood coagulation [inference]

fibrinolysis

regulation of fibrinolysis [inference]

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation [inference]

negative regulation of fibrinolysis

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
carboxypeptidase activity	ISO	GO_REF
carboxypeptidase activity	IDA	PMID
carboxypeptidase activity	IEA	GO_REF
metallocarboxypeptidase activity	IBA	GO_REF
metallocarboxypeptidase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity

metallocarboxypeptidase activity

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

metallopeptidase activity [inference]

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

exopeptidase activity [inference]

carboxypeptidase activity

metallocarboxypeptidase activity

metalloexopeptidase activity [inference]

metallocarboxypeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLHGLGILVAIILYEQHGFAFQSGQVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVDSVKAHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPRASASYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIVWHVIRNT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	Source
43	N-linked (GlcNAc...) asparagine		UniProt GlyGen
72	N-linked (GlcNAc...) asparagine	16944957	UniProt GlyGen
84	N-linked (GlcNAc...) asparagine		GlycoProtDB UniProt GlyGen
107	N-linked (GlcNAc...) asparagine		GlycoProtDB UniProt GlyGen
240	N-linked (GlcNAc...) asparagine		UniProt GlyGen
322	N-linked (GlcNAc...) asparagine		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Metabolism of Angiotensinogen to Angiotensins	Mus musculus
Regulation of Complement cascade	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements