GlyCosmos Portal

Submissions

17-beta-hydroxysteroid dehydrogenase type 6

Summary

UniProt ID: Q9R092
Gene Symbol: Hsd17b6 Gm182 Hsd17b9 Rdh8
Gene ID: 27400
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9R092
The O-GlcNAc Database: Q9R092
Re-Glyco: Q9R092

Annotation

Keyword: Endosome Glycoprotein Membrane Microsome NAD Oxidoreductase Reference proteome Signal Steroid metabolism

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
steroid metabolic process
retinol metabolic process	IBA	GO_REF
brexanolone catabolic process	ISS	GO_REF
brexanolone catabolic process	ISO	GO_REF
brexanolone catabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

steroid catabolic process [inference]

brexanolone catabolic process

small molecule catabolic process [inference]

ketone catabolic process [inference]

brexanolone catabolic process

ketone metabolic process [inference]

ketone catabolic process [inference]

brexanolone catabolic process

brexanolone metabolic process [inference]

brexanolone catabolic process

hormone metabolic process [inference]

retinol metabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

diterpenoid metabolic process [inference]

retinoid metabolic process [inference]

retinol metabolic process

steroid metabolic process

steroid catabolic process [inference]

brexanolone catabolic process

brexanolone metabolic process [inference]

brexanolone catabolic process

lipid catabolic process [inference]

steroid catabolic process [inference]

brexanolone catabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

primary alcohol metabolic process [inference]

retinol metabolic process

small molecule catabolic process [inference]

ketone catabolic process [inference]

brexanolone catabolic process

olefinic compound metabolic process [inference]

retinol metabolic process

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

retinol metabolic process

Displaying 1 entry
GO Term	Evidence Code	Reference
early endosome membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

early endosome membrane

bounding membrane of organelle [inference]

endosome membrane [inference]

early endosome membrane

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	ISO	GO_REF
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IDA	PMID
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA	GO_REF GO_REF
all-trans-retinol dehydrogenase (NAD+) activity	ISO	GO_REF
all-trans-retinol dehydrogenase (NAD+) activity	EXP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

steroid dehydrogenase activity [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

estradiol 17-beta-dehydrogenase [NAD(P)+] activity

17-beta-hydroxysteroid dehydrogenase (NAD+) activity [inference]

testosterone dehydrogenase (NAD+) activity

17-beta-hydroxysteroid dehydrogenase (NADP+) activity [inference]

testosterone dehydrogenase (NADP+) activity

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

alcohol dehydrogenase [NAD(P)+] activity [inference]

alcohol dehydrogenase (NAD+) activity [inference]

all-trans-retinol dehydrogenase (NAD+) activity

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

estradiol 17-beta-dehydrogenase [NAD(P)+] activity

17-beta-hydroxysteroid dehydrogenase (NAD+) activity [inference]

testosterone dehydrogenase (NAD+) activity

17-beta-hydroxysteroid dehydrogenase (NADP+) activity [inference]

testosterone dehydrogenase (NADP+) activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWFYLVTLVGLYHLLRWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGDRGLWGLVNNAGVLQPFAYIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKKARGRIVNVSSALGRVALFGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEMTDAELTIERTKKVWEAAPEHIKESYGQQFFDDFCSTTKRELMKCSRNLSLVTDCMEHALTSTHPRTRYSAGWDAKFFFIPLSYLPASLVDYLLAISRGKPAQAA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites