GlyCosmos Portal

Submissions

Set1/Ash2 histone methyltransferase complex subunit ASH2

Summary

UniProt ID: Q9UBL3
Gene Symbol: ASH2L ASH2L1
Gene ID: 9070
Organism: Homo sapiens (human)

External Links

GlyGen: Q9UBL3
PubChem: Q9UBL3
Re-Glyco: Q9UBL3

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Chromatin regulator DNA-binding Methylation Nucleus Phosphoprotein Proteomics identification Reference proteome Transcription regulation Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cellular response to DNA damage stimulus	IDA	PMID
DNA damage response	IDA	PMID
positive regulation of cell population proliferation	IMP	PMID
hemopoiesis	NAS	PMID
response to estrogen	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

cellular developmental process [inference]

cell development [inference]

hemopoiesis

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

chromatin remodeling [inference]

epigenetic regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

hemopoiesis

cellular developmental process [inference]

cell development [inference]

hemopoiesis

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

response to endogenous stimulus [inference]

response to hormone [inference]

response to estrogen

response to chemical [inference]

response to hormone [inference]

response to estrogen

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

epigenetic regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

epigenetic regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of gene expression, epigenetic [inference]

transcription initiation-coupled chromatin remodeling

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IDA	PMID PMID PMID
nucleus	IMP	PMID
nucleus	IEA	GO_REF
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
nucleoplasm	IDA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

histone methyltransferase complex

MLL1/2 complex

MLL1 complex

catalytic complex [inference]

transferase complex [inference]

methyltransferase complex [inference]

histone methyltransferase complex

MLL1/2 complex

MLL1 complex

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 4** entries
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	IDA	PMID
transcription cis-regulatory region binding	IBA	GO_REF
beta-catenin binding	IPI	PMID
zinc ion binding

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

protein binding [inference]

beta-catenin binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
23			G64409MC	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 11 in total

1

2

Next ›

Last »
Pathway Name	Organism
Activation of anterior HOX genes in hindbrain development during early embryogenesis	Homo sapiens
Deactivation of the beta-catenin transactivating complex	Homo sapiens
Differentiation of naive CD4+ T cells to T helper 2 cells (Th2 cells)	Homo sapiens
Epigenetic regulation of gene expression by MLL3 and MLL4 complexes	Homo sapiens
Formation of WDR5-containing histone-modifying complexes	Homo sapiens
Formation of the beta-catenin:TCF transactivating complex	Homo sapiens
Loss of Function of KMT2D in MLL4 Complex Formation in Kabuki Syndrome	Homo sapiens
MLL4 and MLL3 complexes regulate expression of PPARG target genes in adipogenesis and hepatic steatosis	Homo sapiens
PKMTs methylate histone lysines	Homo sapiens
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements