GlyCosmos Portal

Submissions

Vesicle-associated membrane protein-associated protein A

Summary

UniProt ID: Q9WV55
Gene Symbol: Vapa Vap33
Gene ID: 30960
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q9WV55
PubChem: Q9WV55
RaftProt: Q9WV55
Re-Glyco: Q9WV55

Annotation

Keyword: 3D-structure Acetylation Cell membrane Coiled coil Direct protein sequencing Disulfide bond Endoplasmic reticulum Nucleus Phosphoprotein Reference proteome Tight junction Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 28 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
sphingomyelin biosynthetic process	ISO	GO_REF
sphingomyelin biosynthetic process	IEA	GO_REF
endoplasmic reticulum to Golgi vesicle-mediated transport	ISO	GO_REF
endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	GO_REF
phospholipid transport	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

sphingomyelin metabolic process [inference]

sphingomyelin biosynthetic process

phospholipid biosynthetic process [inference]

sphingomyelin biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

sphingomyelin biosynthetic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

sphingomyelin biosynthetic process

sphingolipid biosynthetic process [inference]

sphingomyelin biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

sphingomyelin biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

sphingomyelin metabolic process [inference]

sphingomyelin biosynthetic process

phospholipid biosynthetic process [inference]

sphingomyelin biosynthetic process

sphingolipid metabolic process [inference]

sphingomyelin metabolic process [inference]

sphingomyelin biosynthetic process

sphingolipid biosynthetic process [inference]

sphingomyelin biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

sphingomyelin biosynthetic process

sphingolipid biosynthetic process [inference]

sphingomyelin biosynthetic process

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular localization [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

vesicle budding from membrane [inference]

COPII-coated vesicle budding

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development

membrane organization [inference]

vesicle budding from membrane [inference]

COPII-coated vesicle budding

viral process [inference]

viral release from host cell

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

host-mediated perturbation of symbiont process [inference]

host-mediated perturbation of viral process [inference]

host-mediated activation of viral process [inference]

host-mediated activation of viral genome replication

host-mediated perturbation of viral genome replication [inference]

host-mediated activation of viral genome replication

host-mediated suppression of viral genome replication

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

exit from host cell [inference]

viral release from host cell

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to organelle [inference]

protein localization to endoplasmic reticulum

establishment of localization [inference]

transport [inference]

lipid transport [inference]

phospholipid transport

sterol transport

cholesterol transport

ceramide transport

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

organophosphate ester transport [inference]

phospholipid transport

organic hydroxy compound transport [inference]

sterol transport

cholesterol transport

vesicle-mediated transport [inference]

Golgi vesicle transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

nitrogen compound transport [inference]

ceramide transport

establishment of localization in cell [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular localization [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISO	GO_REF
Golgi membrane	IEA	GO_REF
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

tight junction [inference]

bicellular tight junction

organelle [inference]

membrane-bounded organelle [inference]

vesicle

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

microtubule cytoskeleton

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular membraneless organelle [inference]

cytoskeleton [inference]

microtubule cytoskeleton

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule binding	ISO	GO_REF
microtubule binding	IEA	GO_REF
protein domain specific binding	ISO	GO_REF
protein domain specific binding	IEA	GO_REF
FFAT motif binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

tubulin binding [inference]

microtubule binding

protein domain specific binding

FFAT motif binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein-containing complex binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

protein-membrane adaptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPLPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSAVSFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites