GlyCosmos Portal

Submissions

NADPH oxidase 1

Summary

UniProt ID: Q9WV87
Gene Symbol: Mox1 Noh1 Nox1
Gene ID: 114243
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q9WV87
Re-Glyco: Q9WV87

Annotation

Keyword: Cell junction Cell membrane Cell projection Electron transport FAD Glycoprotein Heme NADP Oxidoreductase Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
response to reactive oxygen species	IDA	PMID
angiogenesis	ISO	GO_REF
regulation of systemic arterial blood pressure by renin-angiotensin	ISO	GO_REF
glutathione metabolic process	IMP	PMID
defense response	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

modified amino acid metabolic process [inference]

glutathione metabolic process

sulfur compound metabolic process [inference]

glutathione metabolic process

oxygen metabolic process

reactive oxygen species metabolic process [inference]

superoxide metabolic process [inference]

superoxide anion generation

hydrogen peroxide metabolic process

cell motility [inference]

cell migration

cell chemotaxis

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to metal ion [inference]

cellular response to mercury ion

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

multicellular organismal process [inference]

system process [inference]

endocrine process [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by renin-angiotensin

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis

response to stimulus [inference]

response to stress [inference]

defense response

response to oxidative stress [inference]

response to reactive oxygen species

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

response to hyperoxia [inference]

cellular response to hyperoxia

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to increased oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

response to hyperoxia [inference]

cellular response to hyperoxia

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to angiotensin [inference]

cellular response to angiotensin

response to growth factor [inference]

response to platelet-derived growth factor [inference]

cellular response to platelet-derived growth factor stimulus

cellular response to growth factor stimulus [inference]

cellular response to platelet-derived growth factor stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to growth factor stimulus [inference]

cellular response to platelet-derived growth factor stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to angiotensin [inference]

cellular response to angiotensin

response to metal ion [inference]

response to mercury ion [inference]

cellular response to mercury ion

cellular response to metal ion [inference]

cellular response to mercury ion

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to metal ion [inference]

cellular response to mercury ion

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to peptide [inference]

response to cytokine [inference]

response to interleukin-1 [inference]

cellular response to interleukin-1

cellular response to cytokine stimulus [inference]

cellular response to interleukin-1

response to nitrogen compound [inference]

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to angiotensin [inference]

cellular response to angiotensin

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to oxygen-containing compound [inference]

response to reactive oxygen species

response to peptide hormone [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

response to angiotensin [inference]

cellular response to angiotensin

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to chemical stress [inference]

cellular response to hyperoxia

cellular response to metal ion [inference]

cellular response to mercury ion

cellular response to oxygen levels [inference]

cellular response to increased oxygen levels [inference]

cellular response to hyperoxia

cellular response to nitrogen compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

cellular response to oxygen-containing compound [inference]

cellular response to peptide hormone stimulus [inference]

cellular response to angiotensin

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of smooth muscle cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

regulation of vascular associated smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of reactive oxygen species metabolic process

positive regulation of superoxide anion generation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular component biogenesis [inference]

positive regulation of inclusion body assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of neuron differentiation [inference]

regulation of neuron maturation [inference]

negative regulation of neuron maturation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of cell maturation [inference]

regulation of neuron maturation [inference]

negative regulation of neuron maturation

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of integrin biosynthetic process [inference]

positive regulation of integrin biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of reactive oxygen species metabolic process

positive regulation of superoxide anion generation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of integrin biosynthetic process [inference]

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

regulation of reactive oxygen species metabolic process [inference]

regulation of superoxide metabolic process [inference]

regulation of superoxide anion generation [inference]

positive regulation of superoxide anion generation

positive regulation of reactive oxygen species metabolic process

positive regulation of superoxide anion generation

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of inclusion body assembly

regulation of inclusion body assembly [inference]

positive regulation of inclusion body assembly

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of neuron differentiation [inference]

regulation of neuron maturation [inference]

negative regulation of neuron maturation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of cell maturation [inference]

regulation of neuron maturation [inference]

negative regulation of neuron maturation

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of integrin biosynthetic process

positive regulation of reactive oxygen species metabolic process

positive regulation of superoxide anion generation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of JNK cascade

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular component biogenesis [inference]

positive regulation of inclusion body assembly

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

negative regulation of cellular process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of cell maturation [inference]

negative regulation of neuron maturation

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of inclusion body assembly [inference]

positive regulation of inclusion body assembly

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of smooth muscle cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

regulation of vascular associated smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of vascular endothelial growth factor production

regulation of biological quality [inference]

regulation of blood pressure [inference]

regulation of systemic arterial blood pressure [inference]

regulation of systemic arterial blood pressure mediated by a chemical signal [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by renin-angiotensin

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
endosome	ISO	GO_REF
early endosome	ISO	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

NADPH oxidase complex

catalytic complex [inference]

oxidoreductase complex [inference]

NADPH oxidase complex

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

cell projection

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
NAD(P)H oxidase H2O2-forming activity	IMP	PMID
NAD(P)H oxidase H2O2-forming activity	IBA	GO_REF
superoxide-generating NAD(P)H oxidase activity	ISO	GO_REF
superoxide-generating NAD(P)H oxidase activity	TAS	PMID
superoxide-generating NAD(P)H oxidase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on NAD(P)H [inference]

oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor [inference]

NAD(P)H oxidase H2O2-forming activity

superoxide-generating NAD(P)H oxidase activity

superoxide-generating NADPH oxidase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

GTPase binding [inference]

small GTPase binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGNWLVNHWLSVLFLVSWLGLNIFLFVYVFLNYEKSDKYYYTREILGTALALARASALCLNFNSMVILIPVCRNLLSFLRGTCSFCNHTLRKPLDHNLTFHKLVAYMICIFTAIHIIAHLFNFERYSRSQQAMDGSLASVLSSLFHPEKEDSWLNPIQSPNVTVMYAAFTSIAGLTGVVATVALVLMVTSAMEFIRRNYFELFWYTHHLFIIYIICLGIHGLGGIVRGQTEESMSESHPRNCSYSFHEWDKYERSCRSPHFVGQPPESWKWILAPIAFYIFERILRFYRSRQKVVITKVVMHPCKVLELQMRKRGFTMGIGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSIHIRAAGDWTENLIRTFEQQHSPMPRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASFLKSIWYKFQRAHNKLKTQKIYFYWICRETGAFAWFNNLLNSLEQEMDELGKPDFLNYRLFLTGWDSNIAGHAALNFDRATDVLTGLKQKTSFGRPMWDNEFSRIATAHPKSVVGVFLCGPPTLAKSLRKCCRRYSSLDPRKVQFYFNKETF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
161	N-linked (GlcNAc...) asparagine			UniProt
241	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
RAC1 GTPase cycle	Rattus norvegicus
RAC3 GTPase cycle	Rattus norvegicus
RHO GTPases Activate NADPH Oxidases	Rattus norvegicus

Disease

Displaying **all 4** entries
DO ID	Disease Name	Source
DOID:224	transient cerebral ischemia	Alliance of Genome Resources
DOID:8725	vascular dementia	Alliance of Genome Resources
DOID:6432	pulmonary hypertension	Alliance of Genome Resources
DOID:14330	Parkinson's disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements