GlyCosmos Portal

Submissions

Lymphatic vessel endothelial hyaluronic acid receptor 1

Summary

UniProt ID: Q9Y5Y7
Gene Symbol: XLKD1 CRSBP1 HAR UNQ230/PRO263 XLKD1 hCG_23149
Gene ID: 10894
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0012701

GlyConnect

Lymphatic vessel endothelial hyaluronic acid receptor 1

GlyGen

Q9Y5Y7

The Human Metabolome Database

HMDBP10897

Re-Glyco

Q9Y5Y7

Annotation

Keyword: 3D-structure Cell membrane Disulfide bond Glycoprotein Proteomics identification Receptor Reference proteome Signal Transmembrane helix Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of cellular extravasation	IDA	PMID
receptor-mediated endocytosis	IMP	PMID
receptor-mediated endocytosis	IEA	GO_REF GO_REF
cell-matrix adhesion	TAS	PMID
response to wounding	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-substrate adhesion [inference]

cell-matrix adhesion

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

macromolecule metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

hyaluronan metabolic process [inference]

hyaluronan catabolic process

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

hyaluronan metabolic process [inference]

hyaluronan catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process [inference]

hyaluronan catabolic process

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

developmental process [inference]

anatomical structure morphogenesis

response to stimulus [inference]

response to stress [inference]

response to wounding

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of cellular process [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular process [inference]

positive regulation of cellular process [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

regulation of cellular extravasation [inference]

positive regulation of cellular extravasation

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of cellular extravasation

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID Reactome Reactome Reactome
plasma membrane	IDA	PMID
plasma membrane	IMP	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transmembrane signaling receptor activity	IBA	GO_REF
transmembrane signaling receptor activity	IEA	GO_REF
hyaluronic acid binding	IDA	PMID
hyaluronic acid binding	IBA	GO_REF
hyaluronic acid binding	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

hyaluronic acid binding

organic acid binding [inference]

carboxylic acid binding [inference]

hyaluronic acid binding

cargo receptor activity

molecular transducer activity [inference]

signaling receptor activity

transmembrane signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
53	N-linked (GlcNAc...) asparagine	16335952 19159218 23090970 29391424 29741879 30237853 37074911	G89205CJ G31665QC G37818NZ G33791AF G06247RL G47518TP G46842SD G13728QT G99668VU G86795LJ G86880BF G27947YN G56784JY G22310AV G10819WX G40926MX G59536GA G08918WF G00912UN G27058EU G59626AS G80920RR G10486CT	GlycoProtDB UniProt GlyGen GlyConnect
130	N-linked (GlcNAc...) asparagine			UniProt GlyGen
216		30459171	G43417UB	GlyGen
289		23345538 29391424	G37881RL G16407EV G25637MV	GlyGen GlyConnect