GlyCosmos Portal

Submissions

Cholesterol 24-hydroxylase

Summary

UniProt ID: Q9Y6A2
Gene Symbol: CYP46 CYP46A1
Gene ID: 10858
Organism: Homo sapiens (human)

External Links

GlyGen

Q9Y6A2

PubChem

Q9Y6A2

SwissLipids

The Human Metabolome Database

HMDBP05063

The O-GlcNAc Database

Q9Y6A2

O-GlcNAcAtlas

Q9Y6A2

Re-Glyco

Q9Y6A2

Annotation

Keyword: 3D-structure Alternative splicing Cell projection Cholesterol metabolism Heme Microsome Monooxygenase Proteomics identification Reference proteome Synapse Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
bile acid biosynthetic process	TAS	Reactome
cholesterol catabolic process	ISS	GO_REF
cholesterol catabolic process	TAS	PMID
cholesterol catabolic process	IDA	PMID PMID PMID
cholesterol catabolic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

xenobiotic metabolic process

catabolic process [inference]

lipid catabolic process [inference]

steroid catabolic process [inference]

sterol catabolic process [inference]

cholesterol catabolic process

small molecule catabolic process [inference]

alcohol catabolic process [inference]

cholesterol catabolic process

biosynthetic process [inference]

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

ketone metabolic process [inference]

progesterone metabolic process

hormone metabolic process [inference]

C21-steroid hormone metabolic process [inference]

progesterone metabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid catabolic process [inference]

sterol catabolic process [inference]

cholesterol catabolic process

bile acid metabolic process [inference]

bile acid biosynthetic process

C21-steroid hormone metabolic process [inference]

progesterone metabolic process

sterol metabolic process

cholesterol metabolic process [inference]

cholesterol catabolic process

sterol catabolic process [inference]

cholesterol catabolic process

lipid catabolic process [inference]

steroid catabolic process [inference]

sterol catabolic process [inference]

cholesterol catabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

alcohol catabolic process [inference]

cholesterol catabolic process

secondary alcohol metabolic process [inference]

cholesterol metabolic process [inference]

cholesterol catabolic process

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

bile acid metabolic process [inference]

bile acid biosynthetic process

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

small molecule catabolic process [inference]

alcohol catabolic process [inference]

cholesterol catabolic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

olefinic compound metabolic process [inference]

progesterone metabolic process

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to membrane raft

developmental process [inference]

anatomical structure development [inference]

system development [inference]

nervous system development

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

protein localization to membrane raft

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to membrane raft

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of long-term synaptic potentiation

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of long-term synaptic potentiation

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

C21-steroid hormone metabolic process [inference]

progesterone metabolic process

regulation of synaptic plasticity [inference]

regulation of long-term synaptic potentiation

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	TAS	PMID
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	TAS	Reactome
endoplasmic reticulum membrane	IEA	GO_REF GO_REF GO_REF
dendrite	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying entries **11 - 15** of 15 in total

« First

‹ Prev

1

2

3
GO Term	Evidence Code	Reference
cholesterol 24-hydroxylase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
testosterone 6-beta-hydroxylase activity	EXP	PMID
testosterone 6-beta-hydroxylase activity	IEA	GO_REF
testosterone 16-beta-hydroxylase activity	EXP	PMID
testosterone 16-beta-hydroxylase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

monooxygenase activity [inference]

steroid hydroxylase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen [inference]

cholesterol 24-hydroxylase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen [inference]

cholesterol 24-hydroxylase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

iron ion binding

tetrapyrrole binding [inference]

heme binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
83		30620550	G49108TO	GlyGen The O-GlcNAc Database
88		30620550	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Endogenous sterols	Homo sapiens
Synthesis of bile acids and bile salts via 24-hydroxycholesterol	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:10652	Alzheimer's disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements