GlyCosmos Portal

Submissions

Tumor necrosis factor

Summary

UniProt ID: P01375
Gene Symbol: TNF TNFA TNFSF2
Gene ID: 7124
Organism: Homo sapiens (human)

External Links

GlyConnect

Tumor-necrosis factor-alpha

GlyGen

P01375

PubChem

P01375

The Human Metabolome Database

HMDBP02070

Re-Glyco

P01375

Annotation

Keyword: 3D-structure Cell membrane Cytokine Direct protein sequencing Disulfide bond Glycoprotein Myristate Phosphoprotein Proteomics identification Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of **228** in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID PMID
protein polyubiquitination
response to hypoxia	IEA	GO_REF
microglial cell activation	ISS	GO_REF
microglial cell activation	NAS	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

cell activation involved in immune response [inference]

leukocyte activation involved in immune response [inference]

macrophage activation involved in immune response

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response

inflammatory response to antigenic stimulus [inference]

chronic inflammatory response to antigenic stimulus

humoral immune response

innate immune response [inference]

antiviral innate immune response

leukocyte activation [inference]

leukocyte activation involved in inflammatory response [inference]

microglial cell activation

myeloid leukocyte activation [inference]

macrophage activation [inference]

leukocyte activation involved in immune response [inference]

macrophage activation involved in immune response

cellular process [inference]

cell activation [inference]

cell activation involved in immune response [inference]

leukocyte activation involved in immune response [inference]

macrophage activation involved in immune response

leukocyte activation [inference]

leukocyte activation involved in inflammatory response [inference]

microglial cell activation

myeloid leukocyte activation [inference]

macrophage activation [inference]

leukocyte activation involved in immune response [inference]

macrophage activation involved in immune response

glial cell activation [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

leukocyte cell-cell adhesion [inference]

leukocyte adhesion to vascular endothelial cell [inference]

leukocyte tethering or rolling

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

tumor necrosis factor-mediated signaling pathway

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

intracellular signaling cassette [inference]

MAPK cascade [inference]

JNK cascade

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

necroptotic signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

vascular endothelial growth factor production

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

vascular endothelial growth factor production

protein metabolic process [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination [inference]

protein polyubiquitination

macromolecule modification [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination [inference]

protein polyubiquitination

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process

protein metabolic process [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination [inference]

protein polyubiquitination

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

cell population proliferation [inference]

epithelial cell proliferation [inference]

epithelial cell proliferation involved in salivary gland morphogenesis

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to nicotine

cellular response to lipid [inference]

cellular response to toxic substance

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

multicellular organismal process [inference]

cell activation [inference]

cell activation involved in immune response [inference]

leukocyte activation involved in immune response [inference]

macrophage activation involved in immune response

leukocyte activation [inference]

leukocyte activation involved in inflammatory response [inference]

microglial cell activation

myeloid leukocyte activation [inference]

macrophage activation [inference]

leukocyte activation involved in immune response [inference]

macrophage activation involved in immune response

glial cell activation [inference]

cytokine production [inference]

vascular endothelial growth factor production

system process [inference]

muscle system process [inference]

muscle contraction [inference]

striated muscle contraction [inference]

skeletal muscle contraction

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

vasodilation

nervous system process [inference]

cognition

multicellular organismal response to stress [inference]

response to isolation stress

developmental process [inference]

anatomical structure development [inference]

regeneration [inference]

animal organ regeneration [inference]

liver regeneration

tube development [inference]

digestive tract development [inference]

embryonic digestive tract development

animal organ development [inference]

animal organ regeneration [inference]

liver regeneration

embryonic organ development [inference]

embryonic digestive tract development

gland development [inference]

liver development [inference]

liver regeneration

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

osteoclast differentiation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus

defense response to virus [inference]

antiviral innate immune response

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to Gram-negative bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

rhythmic process [inference]

circadian rhythm

response to stimulus [inference]

response to stress [inference]

response to hypoxia

defense response [inference]

inflammatory response

inflammatory response to antigenic stimulus [inference]

chronic inflammatory response to antigenic stimulus

chronic inflammatory response [inference]

chronic inflammatory response to antigenic stimulus

inflammatory response to wounding

neuroinflammatory response [inference]

reactive gliosis

defense response to bacterium [inference]

defense response to Gram-positive bacterium

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to osmotic stress [inference]

response to salt stress

response to wounding [inference]

inflammatory response to wounding

cellular response to stress [inference]

DNA damage response [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

multicellular organismal response to stress [inference]

response to isolation stress

immune response

inflammatory response to antigenic stimulus [inference]

chronic inflammatory response to antigenic stimulus

humoral immune response

innate immune response [inference]

antiviral innate immune response

response to external stimulus [inference]

detection of external stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to mechanical stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to other organism [inference]

response to virus

defense response to virus [inference]

antiviral innate immune response

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to Gram-negative bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to other organism [inference]

response to virus

defense response to virus [inference]

antiviral innate immune response

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to Gram-negative bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

response to abiotic stimulus [inference]

response to osmotic stress [inference]

response to salt stress

response to radiation [inference]

response to ionizing radiation [inference]

cellular response to ionizing radiation

cellular response to radiation [inference]

cellular response to ionizing radiation

detection of abiotic stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to mechanical stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to chemical [inference]

response to acid chemical [inference]

response to amino acid [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

response to xenobiotic stimulus

response to toxic substance [inference]

cellular response to toxic substance

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

response to retinoic acid [inference]

cellular response to retinoic acid

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

cellular response to lipid [inference]

response to nicotine [inference]

cellular response to nicotine

response to stilbenoid [inference]

response to resveratrol

response to antibiotic

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to nicotine

cellular response to lipid [inference]

cellular response to toxic substance

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

response to peptide [inference]

response to cytokine [inference]

response to type II interferon [inference]

cellular response to type II interferon

response to macrophage colony-stimulating factor

cellular response to cytokine stimulus [inference]

cellular response to type II interferon

response to nitrogen compound [inference]

response to amine [inference]

response to amphetamine

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

response to L-glutamate

response to amyloid-beta [inference]

cellular response to amyloid-beta

response to 3,3',5-triiodo-L-thyronine

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to fructose

response to lipopolysaccharide [inference]

cellular response to lipopolysaccharide

response to retinoic acid [inference]

cellular response to retinoic acid

response to alcohol [inference]

response to ethanol

cellular response to oxygen-containing compound [inference]

response to amyloid-beta [inference]

cellular response to amyloid-beta

response to 3,3',5-triiodo-L-thyronine

response to flavonoid [inference]

response to quercetin

response to hydrogen sulfide

response to transition metal nanoparticle [inference]

response to gold nanoparticle

detection of stimulus [inference]

detection of external stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

detection of abiotic stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

detection of stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to nicotine

cellular response to lipid [inference]

cellular response to toxic substance

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to biotic stimulus [inference]

cellular response to molecule of bacterial origin [inference]

cellular response to lipopolysaccharide

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

protein localization to cell periphery [inference]

protein localization to plasma membrane

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

regulation of neutrophil activation [inference]

positive regulation of neutrophil activation

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of lymphocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of B cell mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of immunoglobulin mediated immune response [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of B cell mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of immunoglobulin mediated immune response [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of chronic inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of humoral immune response [inference]

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JNK cascade [inference]

positive regulation of JNK cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of calcium-mediated signaling [inference]

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of calcineurin-mediated signaling [inference]

regulation of calcineurin-NFAT signaling cascade [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of synaptic transmission

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

regulation of insulin secretion

positive regulation of protein transport

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport

positive regulation of protein localization [inference]

positive regulation of protein transport

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to cell surface

regulation of protein localization to cell periphery [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of protein localization to cell surface [inference]

positive regulation of protein localization to cell surface

regulation of transport [inference]

regulation of organic acid transport [inference]

regulation of L-glutamate import across plasma membrane [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of organic acid transport [inference]

regulation of bile acid secretion [inference]

negative regulation of bile acid secretion

regulation of transmembrane transport [inference]

regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

regulation of D-glucose import across plasma membrane [inference]

negative regulation of D-glucose import across plasma membrane

negative regulation of transmembrane transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

regulation of amino acid transmembrane transport [inference]

regulation of amino acid import across plasma membrane [inference]

regulation of L-glutamate import across plasma membrane [inference]

negative regulation of L-glutamate import across plasma membrane

regulation of secretion [inference]

regulation of peptide secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

negative regulation of secretion [inference]

negative regulation of bile acid secretion

regulation of bile acid secretion [inference]

negative regulation of bile acid secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

regulation of protein secretion [inference]

regulation of insulin secretion

positive regulation of transport [inference]

positive regulation of protein transport

negative regulation of transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

negative regulation of secretion [inference]

negative regulation of bile acid secretion

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of L-glutamate import across plasma membrane

regulation of protein transport [inference]

regulation of protein secretion [inference]

regulation of insulin secretion

positive regulation of protein transport

regulation of amine transport [inference]

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of L-glutamate import across plasma membrane

regulation of amino acid transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of L-glutamate import across plasma membrane

regulation of amino acid transmembrane transport [inference]

regulation of amino acid import across plasma membrane [inference]

regulation of L-glutamate import across plasma membrane [inference]

negative regulation of L-glutamate import across plasma membrane

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of lipid localization [inference]

negative regulation of lipid localization [inference]

negative regulation of lipid storage

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of blood vessel endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of synaptic transmission

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of action potential

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of epithelial cell proliferation [inference]

positive regulation of glial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of nitric oxide biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of vitamin metabolic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of synaptic transmission

positive regulation of programmed cell death

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of macrophage derived foam cell differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of cell adhesion

positive regulation of cell-cell adhesion [inference]

positive regulation of heterotypic cell-cell adhesion

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell

positive regulation of leukocyte adhesion to arterial endothelial cell

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of transport [inference]

positive regulation of protein transport

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of macrophage derived foam cell differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hair follicle development

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of blood microparticle formation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of heat generation [inference]

positive regulation of fever generation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of hair follicle development

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of protein localization [inference]

positive regulation of protein transport

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to cell surface

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of transmembrane transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis

negative regulation of cell cycle [inference]

negative regulation of mitotic cell cycle

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex disassembly

negative regulation of cell junction assembly [inference]

negative regulation of bicellular tight junction assembly

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of viral process [inference]

negative regulation of viral genome replication

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

negative regulation of transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

negative regulation of secretion [inference]

negative regulation of bile acid secretion

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

negative regulation of morphogenesis of an epithelium [inference]

negative regulation of branching involved in lung morphogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of nervous system process [inference]

negative regulation of myelination

negative regulation of nervous system development [inference]

negative regulation of neurogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

negative regulation of blood circulation [inference]

negative regulation of heart contraction [inference]

negative regulation of heart rate

negative regulation of lipid localization [inference]

negative regulation of lipid storage

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JNK cascade [inference]

positive regulation of JNK cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of calcium-mediated signaling [inference]

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of calcineurin-mediated signaling [inference]

regulation of calcineurin-NFAT signaling cascade [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

regulation of fever generation [inference]

positive regulation of fever generation

regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of chronic inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of chronic inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

regulation of neuroinflammatory response [inference]

positive regulation of neuroinflammatory response

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of B cell mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of immunoglobulin mediated immune response [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of chronic inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of humoral immune response [inference]

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of humoral immune response [inference]

positive regulation of humoral immune response mediated by circulating immunoglobulin

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

regulation of fever generation [inference]

positive regulation of fever generation

regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of chronic inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

regulation of chronic inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response

positive regulation of acute inflammatory response [inference]

positive regulation of fever generation

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of inflammatory response to antigenic stimulus [inference]

positive regulation of chronic inflammatory response to antigenic stimulus

positive regulation of neuroinflammatory response

regulation of neuroinflammatory response [inference]

positive regulation of neuroinflammatory response

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of vascular wound healing [inference]

negative regulation of vascular wound healing

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of vascular wound healing

regulation of viral process [inference]

negative regulation of viral process [inference]

negative regulation of viral genome replication

regulation of viral life cycle [inference]

regulation of viral genome replication [inference]

negative regulation of viral genome replication

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

regulation of vascular wound healing [inference]

negative regulation of vascular wound healing

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in salivary gland morphogenesis

regulation of branching involved in lung morphogenesis [inference]

negative regulation of branching involved in lung morphogenesis

regulation of morphogenesis of an epithelium [inference]

regulation of branching involved in salivary gland morphogenesis

regulation of branching involved in lung morphogenesis [inference]

negative regulation of branching involved in lung morphogenesis

negative regulation of morphogenesis of an epithelium [inference]

negative regulation of branching involved in lung morphogenesis

regulation of animal organ morphogenesis [inference]

regulation of branching involved in salivary gland morphogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

regulation of cell differentiation [inference]

regulation of macrophage derived foam cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

regulation of epithelial cell differentiation [inference]

regulation of endothelial cell differentiation [inference]

regulation of endothelial cell development [inference]

regulation of establishment of endothelial barrier

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of macrophage derived foam cell differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of fat cell differentiation

negative regulation of fat cell differentiation

regulation of myoblast differentiation [inference]

negative regulation of myoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

negative regulation of cell development [inference]

negative regulation of neurogenesis

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

negative regulation of neurogenesis

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

regulation of endothelial cell development [inference]

regulation of establishment of endothelial barrier

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

negative regulation of morphogenesis of an epithelium [inference]

negative regulation of branching involved in lung morphogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of macrophage derived foam cell differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hair follicle development

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of blood microparticle formation

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of endothelial cell differentiation [inference]

regulation of endothelial cell development [inference]

regulation of establishment of endothelial barrier

regulation of hair follicle development [inference]

positive regulation of hair follicle development

regulation of nervous system development [inference]

regulation of myelination [inference]

negative regulation of myelination

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

negative regulation of neurogenesis

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

regulation of vascular wound healing [inference]

negative regulation of vascular wound healing

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of blood microparticle formation [inference]

positive regulation of blood microparticle formation

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

tumor necrosis factor-mediated signaling pathway

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

toll-like receptor 3 signaling pathway

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

intracellular signaling cassette [inference]

MAPK cascade [inference]

JNK cascade

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

necroptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JNK cascade [inference]

positive regulation of JNK cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of calcium-mediated signaling [inference]

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of calcineurin-mediated signaling [inference]

regulation of calcineurin-NFAT signaling cascade [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of synaptic transmission

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of lipid storage [inference]

negative regulation of lipid storage

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of nitric oxide biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of chemokine production [inference]

regulation of fractalkine production [inference]

positive regulation of fractalkine production

positive regulation of chemokine production

regulation of chemokine (C-X-C motif) ligand 2 production [inference]

positive regulation of chemokine (C-X-C motif) ligand 2 production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of interleukin-18 production [inference]

positive regulation of interleukin-18 production

regulation of interleukin-6 production [inference]

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of interleukin-33 production [inference]

positive regulation of interleukin-33 production

regulation of cytokine production involved in inflammatory response [inference]

positive regulation of cytokine production involved in inflammatory response

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of translational initiation by iron [inference]

positive regulation of translational initiation by iron

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of nitric oxide biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of lipid biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of steroid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of vitamin D biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of nitric oxide biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of vitamin metabolic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

regulation of lipid catabolic process [inference]

negative regulation of lipid catabolic process

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of generation of precursor metabolites and energy [inference]

regulation of cellular respiration [inference]

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

regulation of aerobic respiration [inference]

regulation of oxidative phosphorylation [inference]

negative regulation of oxidative phosphorylation

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein serine/threonine kinase activity [inference]

regulation of MAP kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JUN kinase activity [inference]

positive regulation of JUN kinase activity

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of kinase activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein serine/threonine kinase activity [inference]

regulation of MAP kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JUN kinase activity [inference]

positive regulation of JUN kinase activity

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of chemokine production [inference]

regulation of fractalkine production [inference]

positive regulation of fractalkine production

positive regulation of chemokine production

regulation of chemokine (C-X-C motif) ligand 2 production [inference]

positive regulation of chemokine (C-X-C motif) ligand 2 production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of interleukin-18 production [inference]

positive regulation of interleukin-18 production

regulation of interleukin-6 production [inference]

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of interleukin-33 production [inference]

positive regulation of interleukin-33 production

regulation of cytokine production involved in inflammatory response [inference]

positive regulation of cytokine production involved in inflammatory response

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of translational initiation by iron [inference]

positive regulation of translational initiation by iron

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of translational initiation by iron [inference]

positive regulation of translational initiation by iron

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

regulation of proteolysis [inference]

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein serine/threonine kinase activity [inference]

regulation of MAP kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JUN kinase activity [inference]

positive regulation of JUN kinase activity

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

regulation of amyloid precursor protein catabolic process [inference]

regulation of amyloid-beta formation [inference]

positive regulation of amyloid-beta formation

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of mRNA metabolic process [inference]

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of small molecule metabolic process [inference]

regulation of vitamin metabolic process [inference]

positive regulation of vitamin metabolic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of vitamin D biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of vitamin metabolic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of steroid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of steroid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of vitamin D biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of lipid biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of steroid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of vitamin D biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

regulation of lipid catabolic process [inference]

negative regulation of lipid catabolic process

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

regulation of DNA biosynthetic process [inference]

positive regulation of DNA biosynthetic process

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of mRNA metabolic process [inference]

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

regulation of miRNA metabolic process [inference]

regulation of miRNA transcription [inference]

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription

positive regulation of transcription, DNA-templated

regulation of miRNA transcription [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of translational initiation by iron [inference]

positive regulation of translational initiation by iron

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

regulation of proteolysis [inference]

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein serine/threonine kinase activity [inference]

regulation of MAP kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JUN kinase activity [inference]

positive regulation of JUN kinase activity

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

regulation of amyloid precursor protein catabolic process [inference]

regulation of amyloid-beta formation [inference]

positive regulation of amyloid-beta formation

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

regulation of nitric oxide metabolic process [inference]

regulation of nitric oxide biosynthetic process [inference]

positive regulation of nitric oxide biosynthetic process

regulation of reactive oxygen species metabolic process

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of heterotypic cell-cell adhesion

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of heterotypic cell-cell adhesion [inference]

positive regulation of heterotypic cell-cell adhesion

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of leukocyte adhesion to vascular endothelial cell [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of leukocyte adhesion to arterial endothelial cell [inference]

positive regulation of leukocyte adhesion to arterial endothelial cell

positive regulation of cell adhesion

positive regulation of cell-cell adhesion [inference]

positive regulation of heterotypic cell-cell adhesion

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell

positive regulation of leukocyte adhesion to arterial endothelial cell

regulation of myelination [inference]

negative regulation of myelination

regulation of transmembrane transport [inference]

regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

regulation of D-glucose import across plasma membrane [inference]

negative regulation of D-glucose import across plasma membrane

negative regulation of transmembrane transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

regulation of amino acid transmembrane transport [inference]

regulation of amino acid import across plasma membrane [inference]

regulation of L-glutamate import across plasma membrane [inference]

negative regulation of L-glutamate import across plasma membrane

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of epithelial cell proliferation [inference]

positive regulation of glial cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

positive regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

regulation of synoviocyte proliferation [inference]

positive regulation of synoviocyte proliferation

regulation of hepatocyte proliferation [inference]

positive regulation of hepatocyte proliferation

regulation of glial cell proliferation [inference]

positive regulation of glial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of endothelial cell apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

regulation of cell junction assembly [inference]

negative regulation of cell junction assembly [inference]

negative regulation of bicellular tight junction assembly

regulation of bicellular tight junction assembly [inference]

negative regulation of bicellular tight junction assembly

regulation of organelle assembly [inference]

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

regulation of cell differentiation [inference]

regulation of macrophage derived foam cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

regulation of epithelial cell differentiation [inference]

regulation of endothelial cell differentiation [inference]

regulation of endothelial cell development [inference]

regulation of establishment of endothelial barrier

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of macrophage derived foam cell differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of fat cell differentiation

negative regulation of fat cell differentiation

regulation of myoblast differentiation [inference]

negative regulation of myoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

negative regulation of cell development [inference]

negative regulation of neurogenesis

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

negative regulation of neurogenesis

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

regulation of endothelial cell development [inference]

regulation of establishment of endothelial barrier

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of epithelial cell proliferation [inference]

positive regulation of glial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of nitric oxide biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of DNA biosynthetic process

positive regulation of DNA metabolic process [inference]

positive regulation of DNA biosynthetic process

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of translation [inference]

positive regulation of translational initiation [inference]

positive regulation of translational initiation by iron

positive regulation of protein catabolic process

positive regulation of membrane protein ectodomain proteolysis

positive regulation of proteolysis [inference]

positive regulation of membrane protein ectodomain proteolysis

positive regulation of amyloid precursor protein catabolic process [inference]

positive regulation of amyloid-beta formation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of miRNA metabolic process [inference]

positive regulation of miRNA transcription

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of steroid biosynthetic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of vitamin metabolic process [inference]

positive regulation of vitamin D biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of MAPK cascade

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

positive regulation of calcium-mediated signaling [inference]

positive regulation of calcineurin-mediated signaling [inference]

positive regulation of calcineurin-NFAT signaling cascade

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of synaptic transmission

positive regulation of programmed cell death

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of macrophage derived foam cell differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of cell adhesion

positive regulation of cell-cell adhesion [inference]

positive regulation of heterotypic cell-cell adhesion

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte adhesion to vascular endothelial cell

positive regulation of leukocyte adhesion to arterial endothelial cell

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cytokine production [inference]

negative regulation of production of molecular mediator of immune response [inference]

negative regulation of cytokine production involved in immune response

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA catabolic process [inference]

RNA stabilization [inference]

mRNA stabilization

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA catabolic process [inference]

mRNA stabilization

negative regulation of miRNA metabolic process [inference]

negative regulation of miRNA transcription

negative regulation of cellular respiration [inference]

negative regulation of oxidative phosphorylation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of signal transduction in absence of ligand [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of intracellular signal transduction [inference]

negative regulation of canonical NF-kappaB signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of transmembrane transport [inference]

negative regulation of L-glutamate import across plasma membrane

negative regulation of D-glucose transmembrane transport [inference]

negative regulation of D-glucose import across plasma membrane

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis

negative regulation of cell cycle [inference]

negative regulation of mitotic cell cycle

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex disassembly

negative regulation of cell junction assembly [inference]

negative regulation of bicellular tight junction assembly

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

regulation of neutrophil activation [inference]

positive regulation of neutrophil activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

regulation of nuclear division [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

regulation of organelle assembly [inference]

regulation of podosome assembly [inference]

positive regulation of podosome assembly

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

regulation of protein-containing complex disassembly [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

regulation of podosome assembly [inference]

positive regulation of podosome assembly

regulation of synapse organization

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex disassembly

negative regulation of cell junction assembly [inference]

negative regulation of bicellular tight junction assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of organelle assembly [inference]

positive regulation of podosome assembly

positive regulation of protein-containing complex assembly

positive regulation of podosome assembly

regulation of cell junction assembly [inference]

negative regulation of cell junction assembly [inference]

negative regulation of bicellular tight junction assembly

regulation of bicellular tight junction assembly [inference]

negative regulation of bicellular tight junction assembly

regulation of blood microparticle formation [inference]

positive regulation of blood microparticle formation

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

negative regulation of mitotic cell cycle

regulation of cell cycle process [inference]

regulation of mitotic nuclear division [inference]

positive regulation of mitotic nuclear division

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

negative regulation of cell cycle [inference]

negative regulation of mitotic cell cycle

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of mitotic nuclear division

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

regulation of protein secretion [inference]

regulation of insulin secretion

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of blood vessel endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of mononuclear cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of cytokine production involved in immune response [inference]

negative regulation of cytokine production involved in immune response

regulation of chemokine production [inference]

regulation of fractalkine production [inference]

positive regulation of fractalkine production

positive regulation of chemokine production

regulation of chemokine (C-X-C motif) ligand 2 production [inference]

positive regulation of chemokine (C-X-C motif) ligand 2 production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of interleukin-18 production [inference]

positive regulation of interleukin-18 production

regulation of interleukin-6 production [inference]

regulation of interleukin-8 production [inference]

positive regulation of interleukin-8 production

regulation of interleukin-33 production [inference]

positive regulation of interleukin-33 production

regulation of cytokine production involved in inflammatory response [inference]

positive regulation of cytokine production involved in inflammatory response

regulation of heat generation [inference]

regulation of fever generation [inference]

positive regulation of fever generation

positive regulation of heat generation [inference]

positive regulation of fever generation

regulation of hair cycle [inference]

regulation of hair follicle development [inference]

positive regulation of hair follicle development

regulation of system process [inference]

regulation of nervous system process [inference]

negative regulation of nervous system process [inference]

negative regulation of myelination

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of heart rate [inference]

negative regulation of heart rate

negative regulation of heart contraction [inference]

negative regulation of heart rate

negative regulation of blood circulation [inference]

negative regulation of heart contraction [inference]

negative regulation of heart rate

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

regulation of neutrophil activation [inference]

positive regulation of neutrophil activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of chemokine production

positive regulation of type II interferon production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of heat generation [inference]

positive regulation of fever generation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of neutrophil activation

positive regulation of hair follicle development

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of nervous system process [inference]

negative regulation of myelination

negative regulation of nervous system development [inference]

negative regulation of neurogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

negative regulation of blood circulation [inference]

negative regulation of heart contraction [inference]

negative regulation of heart rate

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in salivary gland morphogenesis

regulation of branching involved in lung morphogenesis [inference]

negative regulation of branching involved in lung morphogenesis

regulation of amyloid-beta clearance [inference]

negative regulation of amyloid-beta clearance

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of endothelial cell differentiation [inference]

regulation of endothelial cell development [inference]

regulation of establishment of endothelial barrier

regulation of hair follicle development [inference]

positive regulation of hair follicle development

regulation of nervous system development [inference]

regulation of myelination [inference]

negative regulation of myelination

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

negative regulation of neurogenesis

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

regulation of vascular wound healing [inference]

negative regulation of vascular wound healing

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis [inference]

negative regulation of vascular wound healing

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of myeloid cell differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of myeloid leukocyte differentiation [inference]

positive regulation of osteoclast differentiation

regulation of action potential [inference]

positive regulation of action potential

regulation of biological quality [inference]

regulation of heart rate [inference]

negative regulation of heart rate

regulation of blood pressure [inference]

negative regulation of blood pressure [inference]

negative regulation of systemic arterial blood pressure

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

regulation of peptide hormone secretion [inference]

regulation of insulin secretion

regulation of membrane potential [inference]

regulation of action potential [inference]

positive regulation of action potential

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

mRNA stabilization

RNA stabilization [inference]

mRNA stabilization

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

vasodilation

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein kinase activity [inference]

positive regulation of protein kinase activity [inference]

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of protein serine/threonine kinase activity [inference]

regulation of MAP kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

regulation of JUN kinase activity [inference]

positive regulation of JUN kinase activity

positive regulation of protein serine/threonine kinase activity [inference]

positive regulation of MAP kinase activity

positive regulation of JUN kinase activity

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
phagocytic cup	ISS	GO_REF
phagocytic cup	IEA	GO_REF
extracellular region	EXP	PMID
extracellular region	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IDA	PMID PMID PMID PMID PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

membrane microdomain [inference]

membrane raft

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

recycling endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

recycling endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

recycling endosome

cell body [inference]

neuronal cell body

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	IDA	PMID
protease binding	IPI	PMID
protease binding	IEA	GO_REF
cytokine activity	TAS	PMID
cytokine activity	IDA	PMID PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

tumor necrosis factor receptor superfamily binding [inference]

tumor necrosis factor receptor binding

enzyme binding [inference]

protease binding

identical protein binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

chromatin-protein adaptor activity [inference]

histone reader activity [inference]

histone H3 reader activity [inference]

histone H3K9ac reader activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
80	O-linked (GalNAc...) serine; in soluble form	8631363	G48818KL G56682BC G74722FL G00031MO G29931IJ	UniProt GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 10** entries
Pathway Name	Organism
Differentiation of naive CD4+ T cells to T helper 1 cells (Th1 cells)	Homo sapiens
Interleukin-10 signaling	Homo sapiens
Interleukin-4 and Interleukin-13 signaling	Homo sapiens
Regulation of TNFR1 signaling	Homo sapiens
TNF signaling	Homo sapiens
TNFR1-induced NF-kappa-B signaling pathway	Homo sapiens
TNFR1-induced proapoptotic signaling	Homo sapiens
TNFR1-mediated ceramide production	Homo sapiens
TNFR2 non-canonical NF-kB pathway	Homo sapiens
Transcriptional regulation of white adipocyte differentiation	Homo sapiens

Disease

Displaying entries **1 - 10** of 83 in total

1

2

3

4

5

…

Next ›

Last »
DO ID	Disease Name	Source
DOID:9744	type 1 diabetes mellitus	Alliance of Genome Resources
DOID:8725	vascular dementia	Alliance of Genome Resources
DOID:9538	multiple myeloma	Alliance of Genome Resources
DOID:409	liver disease	Alliance of Genome Resources
DOID:14453	farmer's lung	Alliance of Genome Resources
DOID:3770	pulmonary fibrosis	Alliance of Genome Resources
DOID:10325	silicosis	Alliance of Genome Resources
DOID:0070508	metabolic dysfunction and alcohol associated liver disease	Alliance of Genome Resources
DOID:0050848	obstructive sleep apnea	Alliance of Genome Resources
DOID:12449	aplastic anemia	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements