GlyCosmos Portal

Submissions

Riboflavin-binding protein

Summary

UniProt ID: P02752
Gene ID: 396449
Organism: Gallus gallus (chicken)

External Links

GlyConnect

Riboflavin-binding protein

GlyGen

P02752

PubChem

P02752

Re-Glyco

P02752

Annotation

Keyword: 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Phosphoprotein Pyrrolidone carboxylic acid Reference proteome Signal Transport

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
riboflavin transport	IDA	PMID
riboflavin transport	IBA	GO_REF
negative regulation of sensory perception of sweet taste	IMP	PMID
negative regulation of sensory perception of bitter taste	IMP	PMID

GO Hierarchy

biological process

localization [inference]

establishment of localization [inference]

transport [inference]

vitamin transport [inference]

riboflavin transport

nitrogen compound transport [inference]

riboflavin transport

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system process [inference]

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of nervous system process [inference]

negative regulation of nervous system process [inference]

regulation of sensory perception [inference]

regulation of sensory perception of sweet taste [inference]

negative regulation of sensory perception of sweet taste

regulation of sensory perception of bitter taste [inference]

negative regulation of sensory perception of bitter taste

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system process [inference]

Displaying 1 entry
GO Term	Evidence Code	Reference
external side of plasma membrane

GO Hierarchy

cellular component

cellular anatomical structure [inference]

side of membrane [inference]

external side of plasma membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
riboflavin transmembrane transporter activity	IDA	PMID
riboflavin transmembrane transporter activity	IBA	GO_REF
signaling receptor activity	IBA	GO_REF
riboflavin binding	IDA	PMID
riboflavin binding	IBA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

vitamin transmembrane transporter activity [inference]

riboflavin transmembrane transporter activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

riboflavin binding

heterocyclic compound binding [inference]

riboflavin binding

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLRFAITLFAVITSSTCQQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLKFEALQQEEGEERR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
53	N-linked (GlcNAc...) asparagine	1637312 8370663	G22310AV G56749GV G48414YA G84467IZ G06356OH G91365ZQ	UniProt GlyGen GlyConnect
164	N-linked (GlcNAc...) asparagine	1637312 8370663	G22310AV G56749GV G48414YA G84467IZ G06356OH G91365ZQ	UniProt GlyGen GlyConnect
unknown		10833030 8370663	G41953RN G47518TP G89877QI G17441OD G86408JD G52527GH G66282NU G75120WS G61278VW G76329HL G02681BC G75607BQ G22310AV G56749GV G12586PN G65540UB G04607LO G67093QB G48414YA G84467IZ G74594TP G78790NZ G91591WO G26759AS G52187WF G45882FV G66766XF G84838NP G26798CI G39619TI G57611UV G20425TQ G59942FB G06356OH G91365ZQ G00951UF G72398FA G94506PU G10562QT G33279YE G48584BU G08076GP G56748EO G79568CQ G04791QM G31916IQ G14260UH G79198BK G93500PH G23432EQ G76807JB G20966TZ G50045TK G31936TA G34527RW G59471TH G57671LP G81295CK G08520NM G33609NS G74916CC G98140IX G23453IV G49889OJ G06110VR G55220VL G60145BJ G85737WG G42039DE G66538GV G14669DU G22768VO	GlyGen GlyConnect