GlyCosmos Portal

Submissions

N-acetylglucosamine-6-sulfatase

Summary

UniProt ID: P15586
Gene Symbol: GNS hCG_1640559
Gene ID: 2799
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011554

GlyConnect

N-acetylglucosamine-6-sulfatase

GlyGen

P15586

PubChem

P15586

The Human Metabolome Database

HMDBP01597

The O-GlcNAc Database

P15586

O-GlcNAcAtlas

P15586

Re-Glyco

P15586

Annotation

Keyword: Alternative splicing Calcium Direct protein sequencing Disease variant Glycoprotein Hydrolase Lysosome Metal-binding Mucopolysaccharidosis Phosphoprotein Proteomics identification Reference proteome Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
glycosaminoglycan catabolic process	TAS	PMID
heparan sulfate proteoglycan catabolic process	IDA	PMID
heparan sulfate proteoglycan catabolic process	IBA	GO_REF
heparan sulfate proteoglycan catabolic process	IEA	GO_REF GO_REF
keratan sulfate proteoglycan catabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process

protein catabolic process [inference]

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

macromolecule metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan catabolic process

macromolecule catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process

protein catabolic process [inference]

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan catabolic process [inference]

heparan sulfate proteoglycan metabolic process [inference]

heparan sulfate proteoglycan catabolic process

keratan sulfate proteoglycan metabolic process [inference]

keratan sulfate proteoglycan catabolic process

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

protein catabolic process [inference]

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan catabolic process [inference]

heparan sulfate proteoglycan metabolic process [inference]

heparan sulfate proteoglycan catabolic process

keratan sulfate proteoglycan metabolic process [inference]

keratan sulfate proteoglycan catabolic process

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

protein catabolic process [inference]

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan catabolic process

glycoprotein metabolic process [inference]

proteoglycan metabolic process [inference]

proteoglycan catabolic process [inference]

heparan sulfate proteoglycan metabolic process [inference]

heparan sulfate proteoglycan catabolic process

keratan sulfate proteoglycan metabolic process [inference]

keratan sulfate proteoglycan catabolic process

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

glycosaminoglycan catabolic process

glycoprotein catabolic process [inference]

proteoglycan catabolic process [inference]

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome Reactome
azurophil granule lumen	TAS	Reactome
azurophil granule	IDA	PMID
lysosomal lumen	TAS	Reactome Reactome
extracellular exosome	HDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

azurophil granule lumen

intracellular organelle lumen [inference]

vacuolar lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

azurophil granule lumen

ficolin-1-rich granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

azurophil granule

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome [inference]

primary lysosome [inference]

azurophil granule

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

azurophil granule

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome [inference]

primary lysosome [inference]

azurophil granule

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

azurophil granule

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
glycosaminoglycan binding	IEA	GO_REF
N-acetylglucosamine-6-sulfatase activity	EXP	PMID
N-acetylglucosamine-6-sulfatase activity	TAS	PMID Reactome
N-acetylglucosamine-6-sulfatase activity	IDA	PMID
N-acetylglucosamine-6-sulfatase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

sulfuric ester hydrolase activity

N-acetylglucosamine-6-sulfatase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

sulfate binding

cation binding [inference]

metal ion binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding

sulfur compound binding [inference]

sulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 22 in total

1

2

3

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
48		24190977		GlyGen
106		24190977		GlyGen
111	N-linked (GlcNAc...) asparagine	23090970 24190977 29741879 37074911	G26377UA G01521EA G53075ES G12745LE G20577LS G11101UV G76915KR G07810QS G99679NM G63136LV G05962QB G49755GI G63980BQ G04854VP G94470IW G20706XG G00912UN G15664MX G46503DX G80920RR G90659AW G77547TA G62765YT G28541PG G31852PQ G90575OW G41247ZX G50282JC G53641QT	GlycoProtDB UniProt GlyGen GlyConnect
112		24190977		GlyGen
117	N-linked (GlcNAc...) asparagine	23090970 24190977	G20991XV	GlycoProtDB UniProt GlyGen
178		24190977		GlyGen
183	N-linked (GlcNAc...) asparagine	12754519 19159218 23090970 24190977 29741879 34089345 37074911	G45395BF G07246CJ G43223CG G00912UN G87661QW G27058EU G83460ZZ G41071NU G86182NS G59626AS G80920RR G65184UU G42124LM G62765YT G11870QZ G47644PP G72790NZ G95177YH G05049YU G85269DF G95865ZB G31852PQ G49955PK G23719VF G11314AS G39188ZX G41247ZX G35029YA G57776ZU G36379GD G02815KT G84349RE G57317CE G92050GC G74724QE G92275SC G14669DU G28681TP	GlycoProtDB UniProt GlyGen GlyConnect
198	N-linked (GlcNAc...) asparagine	24190977 34089345 37074911	G81124ET G70888PK G80479JV G04854VP G94470IW G43669FQ G07246CJ G56307ZW G87389XI G36442WJ G49018RC G72747WU G02886BB G10486CT G95865ZB G84349RE G28681TP	GlycoProtDB UniProt GlyGen
210	N-linked (GlcNAc...) asparagine	24190977 34089345	G45504EY G28681TP	GlycoProtDB UniProt GlyGen
275		23301498 28657654 30059200 32119511 33214551 34019948 34725712 38665916 39302247 39531497 40596516	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Keratan sulfate degradation	Homo sapiens
Lysosome Vesicle Biogenesis	Homo sapiens
MPS IIID - Sanfilippo syndrome D	Homo sapiens
Neutrophil degranulation	Homo sapiens

Human Protein Atlas

ENSG00000135677

Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.

Data available from v23.0.proteinatlas.org. Image credit: Human Protein Atlas

Disease

Displaying **all 5** entries
DO ID	Disease Name	Source
DOID:0111393	mucopolysaccharidosis type IIIC	Glyco-Disease Genes Database
DOID:0111402	mucopolysaccharidosis type IIID	Glyco-Disease Genes Database Alliance of Genome Resources
DOID:0111394	mucopolysaccharidosis type IIIB	Glyco-Disease Genes Database
DOID:12801	mucopolysaccharidosis III	Glyco-Disease Genes Database Alliance of Genome Resources
DOID:0111395	mucopolysaccharidosis type IIIA	Glyco-Disease Genes Database

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements