GlyCosmos Portal

Submissions

GTPase KRas

Summary

UniProt ID: P32883
Gene Symbol: Kras Kras2
Gene ID: 16653
Organism: Mus musculus (house mouse)

External Links

GlyGen: P32883
PubChem: P32883
RaftProt: P32883
Re-Glyco: P32883

Annotation

Keyword: Acetylation Alternative splicing Cell membrane Cytoplasm GTP-binding Hydrolase Isopeptide bond Methylation Palmitate Prenylation Proto-oncogene Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
liver development
Ras protein signal transduction	ISO	GO_REF
Ras protein signal transduction	TAS	PMID
Ras protein signal transduction	IMP	PMID
Ras protein signal transduction	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin-like growth factor receptor signaling pathway

cytokine-mediated signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Ras protein signal transduction

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cell population proliferation [inference]

muscle cell proliferation [inference]

striated muscle cell proliferation [inference]

cardiac muscle cell proliferation

myoblast proliferation

actin filament-based process [inference]

actin cytoskeleton organization

cellular developmental process [inference]

cell differentiation [inference]

muscle cell differentiation [inference]

striated muscle cell differentiation

cell development [inference]

glial cell development [inference]

astrocyte development [inference]

forebrain astrocyte development

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization

reproductive process [inference]

multi-organism reproductive process [inference]

female pregnancy

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

learning [inference]

associative learning [inference]

visual learning

behavior [inference]

learning or memory [inference]

learning [inference]

associative learning [inference]

visual learning

visual behavior [inference]

visual learning

multicellular organismal response to stress [inference]

response to isolation stress

multi-multicellular organism process [inference]

female pregnancy

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

epithelial tube branching involved in lung morphogenesis

anatomical structure development [inference]

cell development [inference]

glial cell development [inference]

astrocyte development [inference]

forebrain astrocyte development

animal gross anatomical part developmental process [inference]

animal organ development [inference]

gland development [inference]

liver development

cellular developmental process [inference]

cell differentiation [inference]

muscle cell differentiation [inference]

striated muscle cell differentiation

cell development [inference]

glial cell development [inference]

astrocyte development [inference]

forebrain astrocyte development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

response to stimulus [inference]

response to stress [inference]

multicellular organismal response to stress [inference]

response to isolation stress

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

visual behavior [inference]

visual learning

response to gravity

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to chemical [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rac protein signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic transmission, GABAergic

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of cellular senescence

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rac protein signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin-like growth factor receptor signaling pathway

cytokine-mediated signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Ras protein signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

regulation of intracellular signal transduction [inference]

regulation of small GTPase mediated signal transduction [inference]

regulation of Rac protein signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic transmission, GABAergic

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

regulation of cell differentiation [inference]

negative regulation of cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Rac protein signal transduction

positive regulation of cellular senescence

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of neuron apoptotic process

negative regulation of cell differentiation

regulation of cellular senescence [inference]

positive regulation of cellular senescence

regulation of biological quality [inference]

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of long-term neuronal synaptic plasticity

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IEA	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

side of membrane [inference]

cytoplasmic side of membrane [inference]

cytoplasmic side of plasma membrane

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	ISO	GO_REF
GTPase activity	TAS	PMID
GTPase activity	IGI	PMID
GTPase activity	IBA	GO_REF
GTPase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

protein binding [inference]

protein domain specific binding [inference]

LRR domain binding

identical protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

protein-containing complex binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

protein-membrane adaptor activity

molecular function regulator activity [inference]

G protein activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCVIM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
85			G13037JM	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 35 in total

1

2

3

4

Next ›

Last »
Pathway Name	Organism
Activation of RAS in B cells	Mus musculus
CD209 (DC-SIGN) signaling	Mus musculus
Ca2+ pathway	Mus musculus
DAP12 signaling	Mus musculus
Downstream signal transduction	Mus musculus
EGFR Transactivation by Gastrin	Mus musculus
Estrogen-stimulated signaling through PRKCZ	Mus musculus
FCERI mediated MAPK activation	Mus musculus
FLT3 Signaling	Mus musculus
FRS-mediated FGFR1 signaling	Mus musculus

Disease

Displaying **all 8** entries
DO ID	Disease Name	Source
DOID:0060688	arteriovenous malformations of the brain	Alliance of Genome Resources
DOID:4905	pancreatic carcinoma	Alliance of Genome Resources
DOID:4928	intrahepatic cholangiocarcinoma	Alliance of Genome Resources
DOID:1324	lung cancer	Alliance of Genome Resources
DOID:0060581	Noonan syndrome 3	Alliance of Genome Resources
DOID:289	endometriosis	Alliance of Genome Resources
DOID:0050458	juvenile myelomonocytic leukemia	Alliance of Genome Resources
DOID:10283	prostate cancer	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements