GlyCosmos Portal

Submissions

Pulmonary surfactant-associated protein D

Summary

UniProt ID: P35247
Gene Symbol: SFTPD COLEC7 PSPD SFTP4
Gene ID: 6441
Organism: Homo sapiens (human)

External Links

PubChem: P35247
The Human Metabolome Database: HMDBP14631
Re-Glyco: P35247

Annotation

Keyword: 3D-structure Calcium Coiled coil Collagen Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Hydroxylation Innate immunity Lectin Proteomics identification Reference proteome Repeat S-nitrosylation Signal Surface film

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of cytokine production	NAS	PMID
receptor-mediated endocytosis	TAS	PMID
respiratory gaseous exchange by respiratory system
negative regulation of interleukin-2 production	TAS	PMID
negative regulation of T cell proliferation	TAS	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

leukocyte migration [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

mononuclear cell migration [inference]

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

macrophage migration [inference]

macrophage chemotaxis

cellular process [inference]

metabolic process [inference]

reactive oxygen species metabolic process

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

mononuclear cell migration [inference]

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

macrophage migration [inference]

macrophage chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

multicellular organismal process [inference]

respiratory gaseous exchange by respiratory system

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

lung alveolus development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

chemical homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

regulation of multicellular organismal process [inference]

regulation of cytokine production

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF
collagen trimer
obsolete extracellular space
lysosome	TAS	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

cellular anatomical structure [inference]

extracellular region

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

coated vesicle [inference]

clathrin-coated vesicle [inference]

clathrin-coated endocytic vesicle

endocytic vesicle

clathrin-coated endocytic vesicle

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

coated vesicle [inference]

clathrin-coated vesicle [inference]

clathrin-coated endocytic vesicle

endocytic vesicle

clathrin-coated endocytic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

coated vesicle [inference]

clathrin-coated vesicle [inference]

clathrin-coated endocytic vesicle

endocytic vesicle

clathrin-coated endocytic vesicle

Displaying **all 2** entries
GO Term	Evidence Code	Reference
carbohydrate binding	TAS	PMID PMID
identical protein binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

carbohydrate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
90	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 10** entries
Pathway Name	Organism
Defective CSF2RA causes SMDP4	Homo sapiens
Defective CSF2RB causes SMDP5	Homo sapiens
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell	Homo sapiens
Regulation of TLR by endogenous ligand	Homo sapiens
SARS-CoV-1 activates/modulates innate immune responses	Homo sapiens
SARS-CoV-2 activates/modulates innate and adaptive immune responses	Homo sapiens
Signal regulatory protein family interactions	Homo sapiens
Surfactant metabolism	Homo sapiens
Toll Like Receptor 4 (TLR4) Cascade	Homo sapiens
Toll Like Receptor TLR1:TLR2 Cascade	Homo sapiens

Human Protein Atlas

ENSG00000133661

Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.

Data available from v23.0.proteinatlas.org. Image credit: Human Protein Atlas

Disease

Displaying **all 9** entries
DO ID	Disease Name	Source
DOID:552	pneumonia	Alliance of Genome Resources
DOID:2841	asthma	Alliance of Genome Resources
DOID:3908	lung non-small cell carcinoma	Alliance of Genome Resources
DOID:12716	newborn respiratory distress syndrome	Alliance of Genome Resources
DOID:3083	chronic obstructive pulmonary disease	Alliance of Genome Resources
DOID:850	lung disease	Alliance of Genome Resources
DOID:11650	bronchopulmonary dysplasia	Alliance of Genome Resources
DOID:4483	rhinitis	Alliance of Genome Resources
DOID:1273	respiratory syncytial virus infectious disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements