GlyCosmos Portal

Submissions

Transcriptional enhancer factor TEF-3

Summary

UniProt ID: Q15561
Gene Symbol: TEAD4 RTEF1 TCF13L1 TEF3
Gene ID: 7004
Organism: Homo sapiens (human)

External Links

GlyGen: Q15561
PubChem: Q15561
The O-GlcNAc Database: Q15561
RaftProt: Q15561
O-GlcNAcAtlas: Q15561
Re-Glyco: Q15561

Annotation

Keyword: 3D-structure Activator Alternative splicing DNA-binding Nucleus Proteomics identification Reference proteome Transcription regulation

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	TAS	PMID
cell fate specification
trophectodermal cell fate commitment
transcription, DNA-templated	IEA	GO_REF
DNA-templated transcription	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

hippo signaling

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

transcription, DNA-templated

cellular developmental process [inference]

cell fate specification

cell fate commitment [inference]

trophectodermal cell fate commitment

reproductive process [inference]

embryo implantation

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

system development [inference]

skeletal system development

muscle structure development [inference]

muscle organ development

cellular developmental process [inference]

cell fate specification

cell fate commitment [inference]

trophectodermal cell fate commitment

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of developmental process [inference]

positive regulation of stem cell population maintenance

positive regulation of multicellular organismal process [inference]

positive regulation of stem cell population maintenance

regulation of developmental process [inference]

positive regulation of developmental process [inference]

positive regulation of stem cell population maintenance

regulation of stem cell population maintenance [inference]

positive regulation of stem cell population maintenance

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

hippo signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of stem cell population maintenance

regulation of stem cell population maintenance [inference]

positive regulation of stem cell population maintenance

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	ISA	GO_REF
nucleus	IDA	PMID
nucleus	IEA	GO_REF
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome
nucleoplasm	IDA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	GO_REF
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	GO_REF
DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

transcription regulator activity [inference]

DNA-binding transcription factor activity

DNA-binding transcription factor activity, RNA polymerase II-specific

DNA-binding transcription activator activity, RNA polymerase II-specific

DNA-binding transcription activator activity [inference]

DNA-binding transcription activator activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
134			G49108TO	GlyGen
140		34019948 39534244	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Formation of axial mesoderm	Homo sapiens
RUNX3 regulates YAP1-mediated transcription	Homo sapiens
Regulation of PD-L1(CD274) transcription	Homo sapiens
YAP1- and WWTR1 (TAZ)-stimulated gene expression	Homo sapiens
Zygotic genome activation (ZGA)	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements