GlyCosmos Portal

Submissions

Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1

Summary

UniProt ID: Q8IV16
Gene Symbol: GPIHBP1 HBP1
Gene ID: 338328
Organism: Homo sapiens (human)

External Links

GlyGen: Q8IV16
PubChem: Q8IV16
Re-Glyco: Q8IV16

Annotation

Keyword: 3D-structure Cell membrane Disease variant Disulfide bond GPI-anchor Lipid-binding Proteomics identification Reference proteome Signal Sulfation Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
intracellular protein transport	ISS	PMID
protein import	ISS	PMID
triglyceride catabolic process	IDA	PMID
protein localization to cell surface	ISS	PMID
cholesterol homeostasis	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process [inference]

triglyceride catabolic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

neutral lipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

lipid catabolic process [inference]

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process [inference]

triglyceride catabolic process

acylglycerol catabolic process [inference]

triglyceride catabolic process

glycerolipid catabolic process [inference]

acylglycerol catabolic process [inference]

triglyceride catabolic process

vesicle-mediated transport [inference]

transcytosis

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

multicellular organismal process [inference]

transcytosis

homeostatic process [inference]

chemical homeostasis [inference]

lipid homeostasis [inference]

acylglycerol homeostasis [inference]

triglyceride homeostasis

sterol homeostasis [inference]

cholesterol homeostasis

response to stimulus [inference]

response to chemical [inference]

response to nitrogen compound [inference]

response to heparin

response to oxygen-containing compound [inference]

response to heparin

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein localization to cell surface

establishment of localization [inference]

transport [inference]

protein transport [inference]

vesicle-mediated transport [inference]

transcytosis

intracellular transport [inference]

intracellular protein transport

establishment of protein localization [inference]

protein transport [inference]

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of cellular component organization [inference]

positive regulation of chylomicron remodeling

positive regulation of multicellular organismal process [inference]

positive regulation of lipoprotein particle clearance [inference]

positive regulation of chylomicron remnant clearance

positive regulation of chylomicron remodeling

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of fatty acid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

regulation of ketone metabolic process [inference]

regulation of fatty acid metabolic process [inference]

regulation of fatty acid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

regulation of small molecule metabolic process [inference]

regulation of fatty acid metabolic process [inference]

regulation of fatty acid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of fatty acid metabolic process [inference]

regulation of fatty acid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

regulation of lipid biosynthetic process [inference]

regulation of fatty acid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of lipid biosynthetic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of fatty acid metabolic process [inference]

positive regulation of fatty acid biosynthetic process

positive regulation of cellular component organization [inference]

positive regulation of chylomicron remodeling

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of chylomicron remodeling

regulation of chylomicron remodeling [inference]

positive regulation of chylomicron remodeling

regulation of multicellular organismal process [inference]

regulation of lipoprotein particle clearance [inference]

positive regulation of lipoprotein particle clearance [inference]

positive regulation of chylomicron remnant clearance

regulation of chylomicron remnant clearance [inference]

positive regulation of chylomicron remnant clearance

positive regulation of multicellular organismal process [inference]

positive regulation of lipoprotein particle clearance [inference]

positive regulation of chylomicron remnant clearance

positive regulation of chylomicron remodeling

regulation of chylomicron remodeling [inference]

positive regulation of chylomicron remodeling

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome
plasma membrane	EXP	PMID
plasma membrane	TAS	Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

catalytic complex

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

plasma membrane region [inference]

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lipid binding
lipase binding	IBA	GO_REF
lipase binding	IPI	PMID PMID
chylomicron binding	IDA	PMID
chylomicron binding	IBA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

protein transporter activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

lipase binding

lipid binding

protein-containing complex binding [inference]

protein-lipid complex binding [inference]

lipoprotein particle binding

chylomicron binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

lipase activator activity [inference]

lipoprotein lipase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

lipase activator activity [inference]

lipoprotein lipase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKALGAVLLALLLFGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
78	N-linked (GlcNAc...) asparagine	29899144 30559189		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Assembly of active LPL and LIPC lipase complexes	Homo sapiens
Chylomicron remodeling	Homo sapiens
Post-translational modification: synthesis of GPI-anchored proteins	Homo sapiens
Retinoid metabolism and transport	Homo sapiens