GlyCosmos Portal

Submissions

UDP-glucuronic acid decarboxylase 1

Summary

UniProt ID: Q8NBZ7
Gene Symbol: UNQ2538/PRO6079 UXS1
Gene ID: 80146
Organism: Homo sapiens (human)

External Links

GlyGen: Q8NBZ7
PubChem: Q8NBZ7
The Human Metabolome Database: HMDBP03150
Re-Glyco: Q8NBZ7

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Decarboxylase Disease variant Endoplasmic reticulum Glycoprotein Golgi apparatus NAD Phosphoprotein Proteomics identification Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
glycosaminoglycan biosynthetic process	IDA	PMID
UDP-D-xylose biosynthetic process	IDA	PMID PMID
UDP-D-xylose biosynthetic process	IEA	GO_REF
D-xylose metabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

organophosphate biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

carbohydrate derivative biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

macromolecule metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan biosynthetic process

macromolecule biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

pentose metabolic process [inference]

D-xylose metabolic process

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

pentose metabolic process [inference]

D-xylose metabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

glycosaminoglycan metabolic process [inference]

glycosaminoglycan biosynthetic process

nucleotide-sugar metabolic process [inference]

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

UDP-D-xylose metabolic process [inference]

UDP-D-xylose biosynthetic process

carbohydrate derivative biosynthetic process [inference]

aminoglycan biosynthetic process [inference]

glycosaminoglycan biosynthetic process

nucleotide-sugar biosynthetic process [inference]

UDP-D-xylose biosynthetic process

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	TAS	Reactome
Golgi membrane	IDA	PMID
Golgi membrane	IEA	GO_REF
cytoplasm
endoplasmic reticulum membrane	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

catalytic complex

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
identical protein binding	IPI	PMID
protein homodimerization activity	IDA	PMID
UDP-glucuronate decarboxylase activity	IDA	PMID PMID PMID PMID PMID
UDP-glucuronate decarboxylase activity	IEA	GO_REF GO_REF GO_REF GO_REF
NAD+ binding	IDA	PMID PMID PMID

GO Hierarchy

molecular function

catalytic activity [inference]

lyase activity [inference]

carbon-carbon lyase activity [inference]

carboxy-lyase activity [inference]

UDP-glucuronate decarboxylase activity

binding [inference]

protein binding [inference]

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

NAD+ binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding [inference]

NAD+ binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding [inference]

NAD+ binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
316	N-linked (GlcNAc...) asparagine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Formation of the active cofactor, UDP-glucuronate	Homo sapiens
Glycosaminoglycan-protein linkage region biosynthesis	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements