GlyCosmos Portal

Submissions

Fibroblast growth factor 23

Summary

UniProt ID: Q9GZV9
Gene Symbol: FGF23 HYPF UNQ3027/PRO9828
Gene ID: 8074
Organism: Homo sapiens (human)

External Links

GlyGen: Q9GZV9
PubChem: Q9GZV9
The Human Metabolome Database: HMDBP02741
Re-Glyco: Q9GZV9

Annotation

Keyword: 3D-structure Differentiation Direct protein sequencing Disease variant Disulfide bond Glycoprotein Growth factor Phosphoprotein Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 26 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of cell population proliferation	IBA	GO_REF
fibroblast growth factor receptor signaling pathway	IBA	GO_REF
regulation of phosphate transport	IDA	PMID
obsolete positive regulation of vitamin D 24-hydroxylase activity
neurogenesis	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

steroid catabolic process [inference]

vitamin D catabolic process

small molecule catabolic process [inference]

vitamin catabolic process [inference]

fat-soluble vitamin catabolic process [inference]

vitamin D catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid catabolic process [inference]

vitamin D catabolic process

vitamin D metabolic process [inference]

vitamin D catabolic process

lipid catabolic process [inference]

steroid catabolic process [inference]

vitamin D catabolic process

small molecule metabolic process [inference]

vitamin metabolic process [inference]

vitamin catabolic process [inference]

fat-soluble vitamin catabolic process [inference]

vitamin D catabolic process

small molecule catabolic process [inference]

vitamin catabolic process [inference]

fat-soluble vitamin catabolic process [inference]

vitamin D catabolic process

cellular developmental process [inference]

cell differentiation [inference]

neurogenesis

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

cellular response to chemical stimulus [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

cellular response to hormone stimulus [inference]

cellular response to lipid [inference]

cellular response to vitamin D

cellular response to oxygen-containing compound [inference]

cellular response to vitamin D

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

neurogenesis

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular phosphate ion homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

monoatomic cation homeostasis [inference]

calcium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular phosphate ion homeostasis

inorganic ion homeostasis [inference]

phosphate ion homeostasis

intracellular phosphate ion homeostasis

calcium ion homeostasis

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

response to leptin [inference]

cellular response to leptin stimulus

response to parathyroid hormone [inference]

cellular response to parathyroid hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

response to nutrient levels [inference]

response to nutrient [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

response to vitamin [inference]

response to vitamin D [inference]

cellular response to vitamin D

cellular response to vitamin [inference]

cellular response to vitamin D

cellular response to nutrient levels [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

response to chemical [inference]

response to nutrient [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

response to vitamin [inference]

response to vitamin D [inference]

cellular response to vitamin D

cellular response to vitamin [inference]

cellular response to vitamin D

response to hormone [inference]

cellular response to hormone stimulus [inference]

response to leptin [inference]

cellular response to leptin stimulus

response to parathyroid hormone [inference]

cellular response to parathyroid hormone stimulus

response to metal ion [inference]

response to magnesium ion

response to lipid [inference]

response to vitamin D [inference]

cellular response to vitamin D

cellular response to lipid [inference]

cellular response to vitamin D

cellular response to chemical stimulus [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

cellular response to hormone stimulus [inference]

cellular response to lipid [inference]

cellular response to vitamin D

cellular response to oxygen-containing compound [inference]

cellular response to vitamin D

response to peptide [inference]

response to cytokine [inference]

response to interleukin-6 [inference]

cellular response to interleukin-6

cellular response to cytokine stimulus [inference]

cellular response to interleukin-6

response to oxygen-containing compound [inference]

response to vitamin D [inference]

cellular response to vitamin D

cellular response to oxygen-containing compound [inference]

cellular response to vitamin D

response to salt [inference]

response to sodium phosphate

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

cellular response to chemical stimulus [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to vitamin D

cellular response to hormone stimulus [inference]

cellular response to lipid [inference]

cellular response to vitamin D

cellular response to oxygen-containing compound [inference]

cellular response to vitamin D

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of hormone secretion

regulation of hormone secretion [inference]

negative regulation of hormone secretion

regulation of localization [inference]

regulation of transport [inference]

regulation of phosphate transport

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

negative regulation of bone mineralization

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

positive regulation of MAPKKK cascade by fibroblast growth factor receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of hormone secretion

regulation of hormone secretion [inference]

negative regulation of hormone secretion

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion

regulation of cell motility [inference]

regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of ossification [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of bone mineralization [inference]

negative regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

negative regulation of bone mineralization

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion

Displaying **all 4** entries
GO Term	Evidence Code	Reference
type 1 fibroblast growth factor receptor binding	IBA	GO_REF
type 1 fibroblast growth factor receptor binding	IEA	GO_REF
growth factor activity	IBA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

fibroblast growth factor receptor binding [inference]

type 1 fibroblast growth factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
171	O-linked (GalNAc) threonine	31932717		UniProt GlyGen
178	O-linked (GalNAc) threonine	16638743 31932717		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 40 in total

1

2

3

4

Next ›

Last »
Pathway Name	Organism
Activated point mutants of FGFR2	Homo sapiens
Constitutive Signaling by Aberrant PI3K in Cancer	Homo sapiens
Downstream signaling of activated FGFR1	Homo sapiens
FGFR1c and Klotho ligand binding and activation	Homo sapiens
FGFR1c ligand binding and activation	Homo sapiens
FGFR2c ligand binding and activation	Homo sapiens
FGFR3c ligand binding and activation	Homo sapiens
FGFR4 ligand binding and activation	Homo sapiens
FGFRL1 modulation of FGFR1 signaling	Homo sapiens
FRS-mediated FGFR1 signaling	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0050948	autosomal dominant hypophosphatemic rickets	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements