GlyCosmos Portal

Annotation

Keyword: 3D-structure ATP-binding Allosteric enzyme Alternative splicing Cytoplasm Developmental protein Disease variant Intellectual disability Magnesium Metal-binding Phosphoprotein Proteomics identification Reference proteome SH3-binding Serine/threonine-protein kinase Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
stimulatory C-type lectin receptor signaling pathway	TAS	Reactome
stimulatory C-type lectin receptor signaling pathway	IEA	GO_REF
axonogenesis	ISS	GO_REF
cellular response to starvation	IBA	GO_REF
dendrite development	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ephrin receptor signaling pathway

intracellular signal transduction

cell motility [inference]

cell migration

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

cellular response to stress [inference]

cellular response to starvation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection organization [inference]

dendritic spine organization [inference]

dendritic spine morphogenesis

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

cell junction organization [inference]

synapse organization

postsynapse organization [inference]

dendritic spine organization [inference]

dendritic spine morphogenesis

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

anatomical structure development [inference]

dendrite development

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

cellular response to starvation

response to starvation [inference]

cellular response to starvation

response to biotic stimulus [inference]

response to lectin [inference]

cellular response to lectin [inference]

stimulatory C-type lectin receptor signaling pathway

response to nutrient levels [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

response to starvation [inference]

cellular response to starvation

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

cellular response to stress [inference]

cellular response to starvation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ephrin receptor signaling pathway

intracellular signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

regulation of protein polymerization [inference]

regulation of actin filament polymerization

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

regulation of axonogenesis

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of protein-containing complex assembly [inference]

regulation of protein polymerization [inference]

regulation of actin filament polymerization

regulation of synapse organization [inference]

regulation of postsynapse organization

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of actin filament length [inference]

regulation of actin polymerization or depolymerization [inference]

regulation of actin filament polymerization

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF
cytosol	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	TAS	Reactome Reactome
postsynaptic density

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

organelle [inference]

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein serine/threonine kinase activity	EXP	PMID
protein serine/threonine kinase activity	TAS	Reactome Reactome Reactome Reactome Reactome Reactome
protein serine/threonine kinase activity	IBA	GO_REF
protein serine/threonine kinase activity	IEA	GO_REF GO_REF
MAP kinase kinase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein serine kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein serine kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein serine kinase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

GTPase binding [inference]

small GTPase binding

protein domain specific binding [inference]

SH3 domain binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
22		24190977		GlyGen
121		24190977		GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 13 in total

1

2

Next ›

Last »
Pathway Name	Organism
Activation of RAC1	Homo sapiens
CD209 (DC-SIGN) signaling	Homo sapiens
CD28 dependent Vav1 pathway	Homo sapiens
CDC42 GTPase cycle	Homo sapiens
Ephrin signaling	Homo sapiens
Generation of second messenger molecules	Homo sapiens
MAPK6/MAPK4 signaling	Homo sapiens
RAC1 GTPase cycle	Homo sapiens
RHO GTPases activate PAKs	Homo sapiens
RHOJ GTPase cycle	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0112051	non-syndromic X-linked intellectual disability 30	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements