GlyCosmos Portal

Submissions

Renin

Summary

UniProt ID

P00797

Gene Symbol

Gene ID

5972

Organism

Homo sapiens (human)

External Links

GlyConnect

Prorenin

GlyGen

P00797

PubChem

P00797

The Human Metabolome Database

HMDBP02624

Re-Glyco

P00797

Annotation

Keyword: 3D-structure Alternative splicing Aspartyl protease Cleavage on pair of basic residues Direct protein sequencing Disease variant Disulfide bond Glycoprotein Membrane Proteomics identification Reference proteome Secreted Signal Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
kidney development	IMP	PMID
mesonephros development	IEA	GO_REF
angiotensin maturation	TAS	Reactome Reactome Reactome
angiotensin maturation	IDA	PMID
angiotensin maturation	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

hormone-mediated signaling pathway

metabolic process [inference]

hormone metabolic process [inference]

peptide hormone processing [inference]

angiotensin maturation

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

protein maturation [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

protein maturation [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

angiotensin maturation

amyloid-beta metabolic process

cellular developmental process [inference]

cell maturation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to xenobiotic stimulus

reproductive process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

gonad development [inference]

male gonad development

multicellular organismal process [inference]

system process [inference]

renal system process [inference]

renal system process involved in regulation of systemic arterial blood pressure [inference]

renin-angiotensin regulation of aldosterone production

behavior [inference]

feeding behavior [inference]

drinking behavior

developmental process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

gonad development [inference]

male gonad development

developmental maturation [inference]

anatomical structure maturation [inference]

cell maturation

anatomical structure development [inference]

animal organ development [inference]

kidney development

mesonephros development

gonad development [inference]

male gonad development

reproductive structure development [inference]

gonad development [inference]

male gonad development

juxtaglomerular apparatus development

cellular developmental process [inference]

cell maturation

response to stimulus [inference]

response to stress [inference]

response to immobilization stress

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to chemical [inference]

response to xenobiotic stimulus [inference]

cellular response to xenobiotic stimulus

response to lipid [inference]

response to lipopolysaccharide

response to organophosphorus [inference]

cellular response to chemical stimulus [inference]

cellular response to xenobiotic stimulus

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to oxygen-containing compound [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to xenobiotic stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of hormone secretion [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of lipid localization [inference]

regulation of lipid transport [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of cellular process [inference]

signal transduction [inference]

hormone-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of hormone secretion [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of endocrine process [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

regulation of biological quality [inference]

regulation of blood pressure

regulation of hormone levels [inference]

hormone metabolic process [inference]

peptide hormone processing [inference]

angiotensin maturation

regulation of hormone secretion [inference]

regulation of steroid hormone secretion [inference]

regulation of corticosteroid hormone secretion [inference]

regulation of mineralocorticoid secretion [inference]

regulation of aldosterone secretion [inference]

renin-angiotensin regulation of aldosterone production

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome
extracellular region	IDA	PMID PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space
plasma membrane	TAS	Reactome Reactome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

apical part of cell

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
aspartic-type endopeptidase activity	EXP	PMID PMID PMID PMID PMID
aspartic-type endopeptidase activity	IDA	PMID PMID
aspartic-type endopeptidase activity	IBA	GO_REF
aspartic-type endopeptidase activity	IEA	GO_REF GO_REF GO_REF
signaling receptor binding	IPI	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

binding [inference]

protein binding [inference]

signaling receptor binding

insulin-like growth factor receptor binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
71	N-linked (GlcNAc...) asparagine	2493678		UniProt GlyGen
141	N-linked (GlcNAc...) asparagine	2493678		UniProt GlyGen
378				GlyGen
unknown		1637829 8038170	G12932QT G63889NK G90093AU G18938DW G47012YE G45359RY G72797UR G86357DX G20425TQ G29857RC G79809MM G23863VK G78059CC G64527OM G67381VP G23869AA G36191CD G50045TK G14889BN G16828VN G72735IY G04689DA G05724UK G93180LE G15956KF G39188ZX G06110VR G55220VL G74724QE G82348BZ G14669DU G22768VO	GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Metabolism of Angiotensinogen to Angiotensins	Homo sapiens

Disease

Displaying **all 5** entries
DO ID	Disease Name	Source
DOID:0060062	autosomal dominant tubulointerstitial kidney disease	Alliance of Genome Resources
DOID:10762	portal hypertension	Alliance of Genome Resources
DOID:10763	hypertension	Alliance of Genome Resources
DOID:10825	essential hypertension	Alliance of Genome Resources
DOID:10881	hand, foot and mouth disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements