GlyCosmos Portal

Submissions

Beta-2-glycoprotein 1

Summary

UniProt ID

P02749

Gene Symbol

APOH
B2G1
hCG_1985715

Gene ID

[350]

Organism

Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011310

GlyConnect

Beta-2-glycoprotein 1

GlyGen

P02749

The Human Metabolome Database

HMDBP01717

RaftProt

P02749

Re-Glyco

P02749

Annotation

Keyword: 3D-structure Direct protein sequencing Disulfide bond Glycoprotein Heparin-binding Proteomics identification Reference proteome Repeat Secreted Signal Sushi

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of endothelial cell proliferation	IDA	PMID
blood coagulation, intrinsic pathway	IDA	PMID
negative regulation of endothelial cell migration	IDA	PMID
negative regulation of angiogenesis	IDA	PMID
positive regulation of blood coagulation	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

protein activation cascade [inference]

blood coagulation, intrinsic pathway

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

protein activation cascade [inference]

blood coagulation, intrinsic pathway

cellular component organization or biogenesis [inference]

cellular component organization [inference]

protein-containing complex organization [inference]

protein-containing complex remodeling [inference]

protein-lipid complex remodeling [inference]

plasma lipoprotein particle remodeling [inference]

triglyceride-rich lipoprotein particle remodeling [inference]

protein-lipid complex organization [inference]

protein-lipid complex remodeling [inference]

plasma lipoprotein particle remodeling [inference]

triglyceride-rich lipoprotein particle remodeling [inference]

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle remodeling [inference]

triglyceride-rich lipoprotein particle remodeling [inference]

multicellular organismal process [inference]

plasma lipoprotein particle organization [inference]

plasma lipoprotein particle remodeling [inference]

triglyceride-rich lipoprotein particle remodeling [inference]

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

acylglycerol transport [inference]

triglyceride transport

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of triglyceride metabolic process

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

positive regulation of hemostasis [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of smooth muscle cell apoptotic process

negative regulation of myeloid cell apoptotic process

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of blood coagulation

regulation of fibrinolysis

negative regulation of fibrinolysis

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

negative regulation of fibrinolysis

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of blood coagulation

regulation of fibrinolysis

negative regulation of fibrinolysis

negative regulation of wound healing [inference]

negative regulation of blood coagulation

positive regulation of wound healing [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

positive regulation of response to wounding [inference]

positive regulation of wound healing [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of triglyceride metabolic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of triglyceride metabolic process

regulation of triglyceride metabolic process [inference]

positive regulation of triglyceride metabolic process

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of muscle cell apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of smooth muscle cell apoptotic process

regulation of smooth muscle cell apoptotic process [inference]

negative regulation of smooth muscle cell apoptotic process

regulation of myeloid cell apoptotic process [inference]

negative regulation of myeloid cell apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of smooth muscle cell apoptotic process

negative regulation of myeloid cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of smooth muscle cell apoptotic process

negative regulation of myeloid cell apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of triglyceride metabolic process

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of endothelial cell proliferation

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of smooth muscle cell apoptotic process

negative regulation of myeloid cell apoptotic process

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of blood coagulation

regulation of fibrinolysis

negative regulation of fibrinolysis

negative regulation of coagulation [inference]

negative regulation of blood coagulation

positive regulation of coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of blood coagulation

regulation of fibrinolysis

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

positive regulation of hemostasis [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

regulation of biological quality [inference]

regulation of body fluid levels [inference]

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

negative regulation of blood coagulation

regulation of fibrinolysis

negative regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

positive regulation of hemostasis [inference]

positive regulation of blood coagulation

negative regulation of fibrinolysis

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF
extracellular region	HDA	PMID PMID PMID PMID
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

protein-lipid complex [inference]

lipoprotein particle [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle

triglyceride-rich plasma lipoprotein particle [inference]

very-low-density lipoprotein particle

chylomicron

extracellular protein-containing complex [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle

triglyceride-rich plasma lipoprotein particle [inference]

very-low-density lipoprotein particle

chylomicron

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

platelet dense granule lumen

intracellular organelle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

platelet dense granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phospholipid binding	IDA	PMID
heparin binding
lipid binding	IDA	PMID
lipase binding	IPI	PMID
identical protein binding	IPI	PMID PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

lipase binding

identical protein binding

lipid binding

phospholipid binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

lipase activator activity [inference]

lipoprotein lipase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

lipase activator activity [inference]

lipoprotein lipase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 8** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
22		28035807	G57321FI	GlyGen
33	O-linked (GalNAc...) threonine			UniProt GlyGen
107		29741879	G75983OB G48414YA G06356OH	GlyConnect
149	O-linked (GalNAc...) threonine			UniProt GlyGen
162	N-linked (GlcNAc...) (complex) asparagine	14760718 15084671 16335952 16740002 18514042 19139490 19159218 19838169 23090970 24417605 24530628 29391424 29671580 29741879 30237853 32125861 34725484 37074911 6587378	G38663NM G12341GU G15169WU G70232NH G94917XT G55216FT G33791AF G06247RL G47518TP G11629QQ G57776ZS G85144OK G77669RF G27947YN G52527GH G94470IW G41126SR G81263BG G92135MA G26403SG G98611JV G40834TG G86500WE G08146BT G22310AV G45395BF G88374WZ G40926MX G59536GA G14972EH G43223CG G40574BA G82830MN G08918WF G47737VJ G75983OB G00912UN G42358LZ G48414YA G72797UR G78644BR G83646BJ G25418HZ G27126ED G08293MJ G27058EU G84452RH G20425TQ G36131WL G86182NS G70619PT G06356OH G59626AS G14994KB G23863VK G31118FR G83555HU G90659AW G31916IQ G45504EY G62765YT G47644PP G10486CT G22140GZ G50045TK G72291OX G95865ZB G72787SB G75798PH G81295CK G11314AS G22572EH G35029YA G57776ZU G36379GD G57317CE G92275SC G28681TP	GlycoProtDB UniProt GlyGen GlyConnect
183	N-linked (GlcNAc...) asparagine	14760718 16335952 19159218 23090970 29741879 37074911 6587378	G85966UN G52848YE G75006KF G64751KD G63040RU G89827JR G07810QS G45526EA G12341GU G75568BH G29545VG G44753VC G86880BF G04854VP G40834TG G02528FI G43669FQ G26330YA G78787DI G00273SJ G08918WF G00912UN G48414YA G49906RN G44211QA G37509XX G60033FS G65184UU G02886BB G10486CT G90575OW G41247ZX	GlycoProtDB UniProt GlyGen GlyConnect
193	N-linked (GlcNAc...) asparagine	14760718 16335952 19159218 23090970 6587378		GlycoProtDB UniProt GlyGen
253	N-linked (GlcNAc...) asparagine	15084671 16335952 16740002 18514042 19159218 23090970 24279413 24530628 29391424 29671580 29741879 32125861 37074911 6587378	G13191RB G11115RO G81637OR G10019LZ G99679NM G56518TU G05962QB G15169WU G70232NH G94917XT G37818NZ G14547CB G70888PK G92081HT G06247RL G47518TP G80075MS G11629QQ G57776ZS G99668VU G86880BF G27947YN G52527GH G56784JY G04854VP G76329HL G94470IW G87123QX G79666IR G92135MA G98611JV G40834TG G22310AV G45395BF G88374WZ G10819WX G40926MX G59536GA G26330YA G10846ZT G40574BA G82830MN G08918WF G75983OB G00912UN G42358LZ G48414YA G78790NZ G58087IP G89098OM G11911BT G46691LC G27126ED G04657PL G08293MJ G27058EU G84452RH G46524LG G46902YN G72747WU G70619PT G06356OH G37868ZX G59626AS G63041LO G90659AW G77547TA G45504EY G29299MO G10486CT G50045TK G18647XP G85269DF G95865ZB G72787SB G22572EH G57776ZU G57317CE G28681TP	GlycoProtDB UniProt GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Platelet degranulation	Homo sapiens

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:5844	myocardial infarction	Alliance of Genome Resources
DOID:341	peripheral vascular disease	Alliance of Genome Resources
DOID:2988	antiphospholipid syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements