GlyCosmos Portal

Submissions

Alpha-2-HS-glycoprotein

Summary

UniProt ID: P02765
Gene Symbol: AHSG FETUA PRO2743
Gene ID: 197
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011331

GlyConnect

Alpha-2-HS-glycoprotein

GlyGen

P02765

PubChem

P02765

The Human Metabolome Database

HMDBP07684

The O-GlcNAc Database

P02765

RaftProt

P02765

Re-Glyco

P02765

Annotation

Keyword: Direct protein sequencing Disease variant Disulfide bond Glycoprotein Hypotrichosis Intellectual disability Mineral balance Phosphoprotein Proteomics identification Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	NAS	PMID
ossification
pinocytosis	NAS	PMID
acute-phase response	IDA	PMID
acute-phase response	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

pinocytosis

multicellular organismal process [inference]

ossification

developmental process [inference]

anatomical structure development [inference]

system development [inference]

skeletal system development

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response [inference]

acute-phase response

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

pinocytosis

import into cell [inference]

endocytosis [inference]

pinocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

regulation of insulin receptor signaling pathway [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of cellular response to insulin stimulus [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of cellular response to insulin stimulus [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of developmental process [inference]

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

regulation of insulin receptor signaling pathway [inference]

negative regulation of insulin receptor signaling pathway

regulation of response to external stimulus [inference]

regulation of inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of cellular response to insulin stimulus [inference]

negative regulation of insulin receptor signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

regulation of inflammatory response

regulation of cellular response to insulin stimulus [inference]

negative regulation of cellular response to insulin stimulus [inference]

negative regulation of insulin receptor signaling pathway

regulation of developmental process [inference]

negative regulation of developmental process [inference]

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization

negative regulation of bone mineralization

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

regulation of insulin receptor signaling pathway [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of insulin receptor signaling pathway

negative regulation of cellular response to insulin stimulus [inference]

negative regulation of insulin receptor signaling pathway

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of phagocytosis

regulation of cellular response to insulin stimulus [inference]

negative regulation of cellular response to insulin stimulus [inference]

negative regulation of insulin receptor signaling pathway

regulation of multicellular organismal process [inference]

regulation of ossification [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of bone mineralization

negative regulation of bone mineralization

negative regulation of multicellular organismal process [inference]

negative regulation of ossification [inference]

negative regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization

negative regulation of bone mineralization

negative regulation of biomineral tissue development [inference]

negative regulation of bone mineralization

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	NAS	PMID PMID
extracellular region	TAS	Reactome Reactome
extracellular region	IBA	GO_REF
extracellular region	IEA	GO_REF
extracellular region	HDA	PMID PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

platelet alpha granule lumen

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

cytoplasmic vesicle lumen [inference]

secretory granule lumen

platelet alpha granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

Golgi apparatus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

blood microparticle

Displaying **all 3** entries
GO Term	Evidence Code	Reference
endopeptidase inhibitor activity	IBA	GO_REF
cysteine-type endopeptidase inhibitor activity	IEA	GO_REF
kinase inhibitor activity	NAS	PMID

GO Hierarchy

molecular function

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity

cysteine-type endopeptidase inhibitor activity

kinase regulator activity [inference]

kinase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity

cysteine-type endopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity

cysteine-type endopeptidase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity

cysteine-type endopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 16 in total

1

2

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
156	N-linked (GlcNAc...) (complex) asparagine	1457416 14760718 16335952 16740002 18514042 19139490 19159218 19838169 22171320 24417605 24530628 24841998 29391424 29671580 29741879 30237853 32125861 37074911 6833285	G32390BU G05528SJ G56518TU G18590ZR G12341GU G15169WU G70232NH G94917XT G98596OT G14547CB G99198RV G81124ET G70888PK G92081HT G06247RL G47518TP G34617SM G80075MS G11629QQ G57776ZS G85144OK G99668VU G60834IK G86795LJ G86880BF G27947YN G52527GH G28622IK G20528HD G04854VP G94470IW G92135MA G40834TG G51413EV G22310AV G45395BF G88374WZ G85554PZ G88061BX G66163OV G40926MX G59536GA G02030ZB G64275UO G49642SA G95977AE G31986NC G26330YA G10846ZT G15038BD G40574BA G82830MN G93683YO G00273SJ G05933EN G08918WF G47737VJ G71146HJ G75983OB G00912UN G42358LZ G48414YA G84467IZ G89098OM G44211QA G15664MX G46691LC G25418HZ G27126ED G04657PL G08293MJ G27058EU G84452RH G46524LG G20425TQ G36131WL G60033FS G46902YN G72747WU G32259BI G70619PT G06356OH G37868ZX G59626AS G14994KB G01650EU G83555HU G90659AW G77547TA G31916IQ G45504EY G83633GK G47644PP G10486CT G22140GZ G50045TK G05049YU G85269DF G72291OX G95865ZB G11314AS G22572EH G57776ZU G57317CE G28681TP G54010QB	GlycoProtDB UniProt GlyGen GlyConnect
176	N-linked (GlcNAc...) (complex) asparagine	12754519 1457416 16335952 16740002 19838169 22171320 24417605 24530628 24841998 29391424 29671580 29741879 29992770 30237853 32125861 34725484 37074911 6833285	G11101UV G76915KR G81637OR G07810QS G99679NM G56518TU G30740WO G12341GU G15169WU G70232NH G94917XT G55132BD G98596OT G14547CB G70888PK G77338BR G92081HT G03644CB G33791AF G06247RL G47518TP G75568BH G80075MS G11629QQ G57776ZS G85144OK G75418YA G99668VU G77669RF G86880BF G27947YN G52527GH G90382BL G63980BQ G04854VP G76329HL G94470IW G87123QX G79666IR G98611JV G81198YO G15488CF G47748JZ G06330RB G40834TG G02528FI G43669FQ G07799LX G51413EV G22310AV G45395BF G88374WZ G59324HL G85554PZ G20706XG G10819WX G40926MX G43223CG G64275UO G58954YZ G95977AE G37412TK G31615DN G31986NC G26330YA G10846ZT G58802FE G60177UT G15038BD G40574BA G82830MN G78787DI G00273SJ G08918WF G47737VJ G75983OB G00912UN G42358LZ G48414YA G84467IZ G49906RN G58087IP G54992WG G83676GD G27915IV G89098OM G11911BT G23505EP G92551JA G61256FT G70441OD G83646BJ G17208MA G15664MX G46691LC G80223IX G27126ED G04657PL G08293MJ G27058EU G84452RH G20425TQ G36131WL G49018RC G46902YN G72747WU G42962KI G44215PV G60923RB G70619PT G06356OH G37868ZX G59626AS G14994KB G23863VK G31118FR G90659AW G31916IQ G45504EY G64409MC G47950XN G47644PP G10486CT G22140GZ G50045TK G85269DF G92597CK G95865ZB G72787SB G22572EH G57776ZU G57317CE G28681TP G54010QB G84225JN	GlycoProtDB UniProt GlyGen GlyConnect
186		30444036 37340703 38665916	G49108TO	The O-GlcNAc Database
196		30459171	G43417UB	GlyGen
197		30459171	G43417UB	GlyGen
202		30459171	G43417UB	GlyGen
256		26598643 6833285	G17015OC G65562ZE	GlyGen
270	O-linked (GalNAc...) threonine	1457416 24417605 26598643 30459171 6833285	G23729WG G68008QO G81006GJ G17015OC G17041QN G65562ZE G74722FL G43417UB	UniProt GlyGen GlyConnect
280	O-linked (GalNAc...) serine	30459171	G53434XO G40740AD G27391WQ G43417UB G29068FM	UniProt GlyGen
293	O-linked (GalNAc...) serine	30459171	G43417UB G29068FM	UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Neutrophil degranulation	Homo sapiens
Platelet degranulation	Homo sapiens
Post-translational protein phosphorylation	Homo sapiens
Regulation of IGF Activity by IGFBP	Homo sapiens

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:9352	type 2 diabetes mellitus	Alliance of Genome Resources
DOID:0080628	alopecia-mental retardation syndrome 1	Alliance of Genome Resources
DOID:3393	coronary artery disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements