GlyCosmos Portal

Submissions

Tubulin beta chain

Summary

UniProt ID: P07437
Gene Symbol: OK/SW-cl.56 TUBB TUBB5
Gene ID: 203068
Organism: Homo sapiens (human)

External Links

GlyGen: P07437
PubChem: P07437
The Human Metabolome Database: HMDBP08048
The O-GlcNAc Database: P07437
RaftProt: P07437
O-GlcNAcAtlas: P07437
Re-Glyco: P07437

Annotation

Keyword: 3D-structure Acetylation Cytoskeleton Direct protein sequencing Disease variant GTP-binding Isopeptide bond Magnesium Metal-binding Methylation Microtubule Phosphoprotein Proteomics identification Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization
mitotic cell cycle	IBA	GO_REF
microtubule-based process	TAS	PMID
microtubule-based process	IEA	GO_REF
cytoskeleton-dependent intracellular transport	TAS	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

lymphocyte mediated immunity [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

cellular process [inference]

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

microtubule-based process

microtubule cytoskeleton organization

spindle organization [inference]

spindle assembly

cell cycle [inference]

mitotic cell cycle

cell cycle process [inference]

spindle organization [inference]

spindle assembly

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

columnar/cuboidal epithelial cell differentiation [inference]

neuroepithelial cell differentiation [inference]

odontoblast differentiation

cell division

cellular localization [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

spindle organization [inference]

spindle assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

spindle assembly

cellular component assembly [inference]

organelle assembly [inference]

membraneless organelle assembly [inference]

spindle assembly

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

columnar/cuboidal epithelial cell differentiation [inference]

neuroepithelial cell differentiation [inference]

odontoblast differentiation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

localization [inference]

establishment of localization [inference]

transport [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport

establishment of localization in cell [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport

cellular localization [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of cellular component organization [inference]

regulation of synapse organization

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
nucleus	IEA	GO_REF
nucleus	HDA	PMID
nuclear envelope lumen	IDA	PMID
cytoplasm	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

membrane [inference]

membrane microdomain [inference]

membrane raft

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

azurophil granule lumen

intracellular organelle lumen [inference]

vacuolar lumen [inference]

azurophil granule lumen

organelle envelope lumen [inference]

nuclear envelope lumen

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

azurophil granule lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

cytoskeleton

microtubule cytoskeleton

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

cytoskeleton

microtubule cytoskeleton

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

microtubule

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	IEA	GO_REF
structural molecule activity	TAS	PMID
structural constituent of cytoskeleton	IBA	GO_REF
structural constituent of cytoskeleton	IEA	GO_REF GO_REF
GTP binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

structural molecule activity

structural constituent of cytoskeleton

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

MHC protein binding [inference]

MHC class I protein binding

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

protein-containing complex binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 11 in total

1

2

Next ›

Last »
Position	PubMed ID	GlyTouCan ID	Source
78	18369606 26853435 30397120 31373491 32119511 33214551 34019948 34725712 35008409 35083852 35138101 37217939 37340703 38253038 38665916 40596516 40914422	G49108TO	GlyGen The O-GlcNAc Database
107	18369606 26853435 30397120 31373491 32119511 33214551 34019948 34725712 35008409 35083852 35138101 37217939 37340703 38253038 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
126	18369606 26853435 30397120 31373491 32119511 33214551 34019948 34725712 35008409 35083852 35138101 37217939 37340703 38253038 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
168	18369606 26853435 30397120 31373491 32119511 33214551 34019948 34725712 35008409 35083852 35138101 37217939 37340703 38253038 38665916 40596516 40914422	G49108TO	GlyGen The O-GlcNAc Database
172		G49108TO	GlyGen
274	18369606 26853435 30397120 31373491 32119511 33214551 34019948 34725712 35008409 35083852 35138101 37217939 37340703 38253038 38665916 40596516 40914422	G49108TO	GlyGen The O-GlcNAc Database
275		G49108TO	GlyGen
285	18369606 26853435 30397120 31373491 32119511 33214551 34019948 34725712 35008409 35083852 35138101 37217939 37340703 38253038 38665916 40596516 40914422	G49108TO	GlyGen The O-GlcNAc Database
290		G49108TO	GlyGen
366		G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 9** entries
Pathway Name	Organism
AURKA Activation by TPX2	Homo sapiens
Anchoring of the basal body to the plasma membrane	Homo sapiens
Loss of Nlp from mitotic centrosomes	Homo sapiens
Loss of proteins required for interphase microtubule organization from the centrosome	Homo sapiens
Neutrophil degranulation	Homo sapiens
Potential therapeutics for SARS	Homo sapiens
Recruitment of NuMA to mitotic centrosomes	Homo sapiens
Recruitment of mitotic centrosome proteins and complexes	Homo sapiens
Regulation of PLK1 Activity at G2/M Transition	Homo sapiens

Human Protein Atlas

ENSG00000196230

Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.

Data available from v23.0.proteinatlas.org. Image credit: Human Protein Atlas

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:0090136	complex cortical dysplasia with other brain malformations 6	Alliance of Genome Resources
DOID:0112242	congenital symmetric circumferential skin creases 1	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements