GlyCosmos Portal

Submissions

Group IID secretory phospholipase A2

Summary

UniProt ID: Q9UNK4
Gene Symbol: PLA2G2D SPLASH
Gene ID: 26279
Organism: Homo sapiens (human)

External Links

PubChem

Q9UNK4

SwissLipids

SLP:000000652

The Human Metabolome Database

HMDBP00073

Re-Glyco

Q9UNK4

Annotation

Keyword: Alternative splicing Calcium Disulfide bond Glycoprotein Hydrolase Lipid degradation Metal-binding Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation
regulation of acute inflammatory response to antigenic stimulus	ISS	GO_REF
regulation of acute inflammatory response to antigenic stimulus	IEA	GO_REF
phospholipid metabolic process	TAS	PMID
phospholipid metabolic process	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

T cell activation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

T cell activation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process

glycerophospholipid metabolic process [inference]

organophosphate metabolic process [inference]

phospholipid metabolic process

glycerophospholipid metabolic process [inference]

catabolic process [inference]

lipid catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process

glycerophospholipid metabolic process [inference]

lipid catabolic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

T cell activation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

regulatory T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

fatty acid transport [inference]

long-chain fatty acid transport [inference]

arachidonate transport [inference]

arachidonic acid secretion

organic anion transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport [inference]

long-chain fatty acid transport [inference]

arachidonate transport [inference]

arachidonic acid secretion

icosanoid transport [inference]

icosanoid secretion [inference]

arachidonic acid secretion

arachidonate transport [inference]

arachidonic acid secretion

organic acid transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport [inference]

long-chain fatty acid transport [inference]

arachidonate transport [inference]

arachidonic acid secretion

icosanoid transport [inference]

icosanoid secretion [inference]

arachidonic acid secretion

arachidonate transport [inference]

arachidonic acid secretion

secretion [inference]

icosanoid secretion [inference]

arachidonic acid secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

regulation of acute inflammatory response to antigenic stimulus

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

regulation of acute inflammatory response to antigenic stimulus

regulation of inflammatory response to antigenic stimulus [inference]

regulation of acute inflammatory response to antigenic stimulus

regulation of immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

regulation of acute inflammatory response to antigenic stimulus

regulation of response to stress [inference]

regulation of defense response [inference]

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

regulation of acute inflammatory response to antigenic stimulus

regulation of inflammatory response to antigenic stimulus [inference]

regulation of acute inflammatory response to antigenic stimulus

regulation of cellular process [inference]

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

Displaying **all 2** entries
GO Term	Evidence Code	Reference
extracellular region	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
A2-type glycerophospholipase activity	TAS	PMID
A2-type glycerophospholipase activity	IDA	PMID
A2-type glycerophospholipase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
calcium ion binding	IBA	GO_REF
calcium ion binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity [inference]

A2-type glycerophospholipase activity

carboxylic ester hydrolase activity [inference]

A2-type glycerophospholipase activity

binding [inference]

protein binding [inference]

proteoglycan binding [inference]

heparan sulfate proteoglycan binding

lipid binding [inference]

phospholipid binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

proteoglycan binding [inference]

heparan sulfate proteoglycan binding

sulfur compound binding [inference]

heparin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
89	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Acyl chain remodelling of PC	Homo sapiens
Acyl chain remodelling of PE	Homo sapiens
Acyl chain remodelling of PG	Homo sapiens
Acyl chain remodelling of PI	Homo sapiens
Acyl chain remodelling of PS	Homo sapiens
Synthesis of PA	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements