GlyCosmos Portal

Submissions

Tubulin beta-4B chain

Summary

UniProt ID: P68371
Gene Symbol: TUBB2C TUBB4B
Gene ID: 10383
Organism: Homo sapiens (human)

External Links

GlyGen: P68371
PubChem: P68371
The Human Metabolome Database: HMDBP08046
The O-GlcNAc Database: P68371
RaftProt: P68371
Re-Glyco: P68371

Annotation

Keyword: 3D-structure Acetylation Cytoskeleton Deafness Disease variant Flagellum GTP-binding Isopeptide bond Leber congenital amaurosis Magnesium Metal-binding Microtubule Phosphoprotein Proteomics identification Reference proteome

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization
mitotic cell cycle	IBA	GO_REF
flagellated sperm motility	IEA	GO_REF
natural killer cell mediated cytotoxicity	NAS	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

lymphocyte mediated immunity [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

cellular process [inference]

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

microtubule-based process [inference]

microtubule cytoskeleton organization

microtubule-based movement [inference]

cilium movement [inference]

cilium movement involved in cell motility [inference]

flagellated sperm motility

cell cycle [inference]

mitotic cell cycle

cell motility [inference]

cilium or flagellum-dependent cell motility [inference]

cilium-dependent cell motility [inference]

flagellated sperm motility

sperm motility [inference]

flagellated sperm motility

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

reproductive process [inference]

sperm motility [inference]

flagellated sperm motility

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome
nucleus	HDA	PMID
cytoplasm
cytosol	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
cytoskeleton	TAS	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

azurophil granule lumen

intracellular organelle lumen [inference]

vacuolar lumen [inference]

azurophil granule lumen

cytoplasmic vesicle lumen [inference]

secretory granule lumen [inference]

azurophil granule lumen

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

organelle [inference]

membrane-bounded organelle [inference]

cilium [inference]

motile cilium [inference]

9+2 motile cilium [inference]

sperm flagellum

vesicle [inference]

extracellular vesicle

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle

extracellular exosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

cytoskeleton

microtubule cytoskeleton

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

cytoskeleton

microtubule cytoskeleton

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle

extracellular exosome

intercellular bridge

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

microtubule

cytoplasmic microtubule [inference]

axonemal microtubule

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
double-stranded RNA binding	IDA	PMID
GTPase activity	IEA	GO_REF
structural constituent of cytoskeleton	IBA	GO_REF
structural constituent of cytoskeleton	IEA	GO_REF
GTP binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

structural molecule activity [inference]

structural constituent of cytoskeleton

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

double-stranded RNA binding

protein binding [inference]

signaling receptor binding [inference]

MHC protein binding [inference]

MHC class I protein binding

unfolded protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	PubMed ID	GlyTouCan ID	Source
168	16408927 18369606 26165356 26853435 30397120 32119511 33214551 34019948 35083852 37217939 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
172	16408927 18369606 26165356 26853435 30397120 32119511 33214551 34019948 35083852 37217939 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
285	16408927 18369606 26165356 26853435 30397120 32119511 33214551 34019948 35083852 37217939 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
290	16408927 18369606 26165356 26853435 30397120 32119511 33214551 34019948 35083852 37217939 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
366	16408927 18369606 26165356 26853435 30397120 32119511 33214551 34019948 35083852 37217939 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database
370		G76264IE	GlyGen
382	16408927 18369606 26165356 26853435 30397120 32119511 33214551 34019948 35083852 37217939 38665916 40596516 40914422	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 38 in total

1

2

3

4

Next ›

Last »
Pathway Name	Organism
AURKA Activation by TPX2	Homo sapiens
Activation of AMPK downstream of NMDARs	Homo sapiens
Aggrephagy	Homo sapiens
Anchoring of the basal body to the plasma membrane	Homo sapiens
Assembly and cell surface presentation of NMDA receptors	Homo sapiens
COPI-dependent Golgi-to-ER retrograde traffic	Homo sapiens
COPI-independent Golgi-to-ER retrograde traffic	Homo sapiens
COPI-mediated anterograde transport	Homo sapiens
Carboxyterminal post-translational modifications of tubulin	Homo sapiens
Cargo trafficking to the periciliary membrane	Homo sapiens

Human Protein Atlas

ENSG00000188229

Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.

Data available from v23.0.proteinatlas.org. Image credit: Human Protein Atlas

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0112240	Leber congenital amaurosis with early-onset deafness	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements