GlyCosmos Portal

Submissions

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2

Summary

UniProt ID: Q92925
Gene Symbol: SMARCD2 BAF60B PRO2451
Gene ID: 6603
Organism: Homo sapiens (human)

External Links

GlyGen: Q92925
The O-GlcNAc Database: Q92925
O-GlcNAcAtlas: Q92925
Re-Glyco: Q92925

Annotation

Keyword: Alternative splicing Chromatin regulator Isopeptide bond Methylation Nucleus Phosphoprotein Proteomics identification Reference proteome Transcription regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleosome disassembly	IEA	GO_REF
chromatin remodeling	NAS	PMID
chromatin remodeling	IDA	PMID PMID
chromatin remodeling	HDA	PMID
regulation of transcription by RNA polymerase II	NAS	PMID PMID PMID PMID

GO Hierarchy

biological process

cellular process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

chromatin remodeling

nucleosome organization [inference]

nucleosome disassembly

cellular component disassembly [inference]

protein-containing complex disassembly [inference]

protein-DNA complex disassembly [inference]

nucleosome disassembly

protein-containing complex organization [inference]

protein-containing complex disassembly [inference]

protein-DNA complex disassembly [inference]

nucleosome disassembly

protein-DNA complex organization [inference]

protein-DNA complex disassembly [inference]

nucleosome disassembly

nucleosome organization [inference]

nucleosome disassembly

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

positive regulation of cell differentiation

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of myoblast differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of response to stimulus [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

positive regulation of developmental process [inference]

positive regulation of cell differentiation

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of myoblast differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of DNA repair [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of double-strand break repair [inference]

positive regulation of double-strand break repair

regulation of nucleotide-excision repair

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of myoblast differentiation

regulation of myoblast differentiation [inference]

positive regulation of myoblast differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of myoblast differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of DNA metabolic process [inference]

regulation of DNA repair [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of double-strand break repair [inference]

positive regulation of double-strand break repair

regulation of nucleotide-excision repair

positive regulation of DNA metabolic process [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of DNA metabolic process [inference]

regulation of DNA repair [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of double-strand break repair [inference]

positive regulation of double-strand break repair

regulation of nucleotide-excision repair

positive regulation of DNA metabolic process [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of cell differentiation [inference]

positive regulation of cell differentiation

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of myoblast differentiation

regulation of myoblast differentiation [inference]

positive regulation of myoblast differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

positive regulation of cell differentiation

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of myoblast differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of chromosome organization [inference]

regulation of sister chromatid segregation [inference]

regulation of metaphase/anaphase transition of cell cycle [inference]

regulation of mitotic metaphase/anaphase transition

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic cell cycle phase transition [inference]

regulation of cell cycle process [inference]

regulation of chromosome segregation [inference]

regulation of sister chromatid segregation [inference]

regulation of metaphase/anaphase transition of cell cycle [inference]

regulation of mitotic metaphase/anaphase transition

regulation of G0 to G1 transition

regulation of cell cycle phase transition [inference]

regulation of mitotic cell cycle phase transition [inference]

regulation of metaphase/anaphase transition of cell cycle [inference]

regulation of mitotic metaphase/anaphase transition

regulation of cell cycle G1/S phase transition [inference]

regulation of G1/S transition of mitotic cell cycle

regulation of cellular response to stress [inference]

regulation of DNA repair [inference]

positive regulation of DNA repair [inference]

positive regulation of double-strand break repair

regulation of double-strand break repair [inference]

positive regulation of double-strand break repair

regulation of nucleotide-excision repair

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
kinetochore	NAS	PMID
chromatin	NAS	PMID
chromatin	HDA	PMID
nucleus	IEA	GO_REF
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome

GO Hierarchy

cellular component

protein-containing complex

nuclear protein-containing complex [inference]

SWI/SNF superfamily-type complex [inference]

catalytic complex [inference]

ATPase complex [inference]

SWI/SNF superfamily-type complex [inference]

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

kinetochore

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

kinetochore

supramolecular complex [inference]

kinetochore

Displaying **all 2** entries
GO Term	Evidence Code	Reference
transcription coregulator activity	IBA	GO_REF
transcription coactivator activity	NAS	PMID

GO Hierarchy

molecular function

transcription regulator activity [inference]

transcription coregulator activity

transcription coactivator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFRPMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	PubMed ID	GlyTouCan ID	Source
217			GlyGen
221			GlyGen
299	29351928 33214551 34019948 37217939 40596516 40914422	G49108TO G70994MS	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Formation of neuronal progenitor and neuronal BAF (npBAF and nBAF)	Homo sapiens
Formation of the embryonic stem cell BAF (esBAF) complex	Homo sapiens
Formation of the non-canonical BAF (ncBAF) complex	Homo sapiens
Formation of the polybromo-BAF (pBAF) complex	Homo sapiens
RMTs methylate histone arginines	Homo sapiens
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known	Homo sapiens
Regulation of MITF-M-dependent genes involved in pigmentation	Homo sapiens
Regulation of endogenous retroelements by Piwi-interacting RNAs (piRNAs)	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements