GlyCosmos Portal

Submissions

Erythropoietin

Summary

UniProt ID: P01588
Gene Symbol: EPO
Gene ID: 2056
Organism: Homo sapiens (human)

External Links

GlyConnect

Erythropoietin

GlyGen

P01588

PubChem

P01588

Re-Glyco

P01588

Annotation

Keyword: 3D-structure Congenital erythrocytosis Direct protein sequencing Disease variant Disulfide bond Erythrocyte maturation Glycoprotein Hormone Pharmaceutical Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 41 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IMP	PMID
response to hypoxia	IEA	GO_REF
acute-phase response	IEA	GO_REF
signal transduction	NAS	PMID
embryo implantation

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

erythropoietin-mediated signaling pathway

cell surface receptor signaling pathway via STAT

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

hemoglobin biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

hemoglobin biosynthetic process

protein metabolic process [inference]

hemoglobin metabolic process [inference]

hemoglobin biosynthetic process

primary metabolic process [inference]

protein metabolic process [inference]

hemoglobin metabolic process [inference]

hemoglobin biosynthetic process

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

myeloid cell apoptotic process

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

erythrocyte differentiation

cell maturation [inference]

erythrocyte maturation

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

reproductive process [inference]

embryo implantation

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

blood circulation

developmental process [inference]

developmental maturation [inference]

anatomical structure maturation [inference]

cell maturation [inference]

erythrocyte maturation

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

erythrocyte differentiation

cell maturation [inference]

erythrocyte maturation

response to stimulus [inference]

response to stress [inference]

response to hypoxia

defense response [inference]

inflammatory response [inference]

acute inflammatory response [inference]

acute-phase response

response to osmotic stress [inference]

hyperosmotic response [inference]

cellular hyperosmotic response

response to salt stress

cellular response to osmotic stress [inference]

cellular hyperosmotic response

response to wounding [inference]

response to axon injury

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

response to hyperoxia

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to abiotic stimulus [inference]

response to osmotic stress [inference]

hyperosmotic response [inference]

cellular hyperosmotic response

response to salt stress

cellular response to osmotic stress [inference]

cellular hyperosmotic response

response to electrical stimulus

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

response to increased oxygen levels [inference]

response to hyperoxia

cellular response to abiotic stimulus [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

response to endogenous stimulus [inference]

response to hormone [inference]

response to estrogen

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

response to dexamethasone

response to nutrient levels [inference]

response to nutrient [inference]

response to vitamin [inference]

response to vitamin A

response to chemical [inference]

response to nutrient [inference]

response to vitamin [inference]

response to vitamin A

response to hormone [inference]

response to estrogen

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

response to dexamethasone

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

response to dexamethasone

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

response to peptide [inference]

response to cytokine [inference]

response to interleukin-1

response to oxygen-containing compound [inference]

response to lipopolysaccharide

response to ketone [inference]

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to osmotic stress [inference]

cellular hyperosmotic response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic ion transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

negative regulation of calcium ion transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic ion transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of monoatomic ion transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of monoatomic ion transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of cellular localization [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of erythrocyte apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of monoatomic ion transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of response to stress [inference]

regulation of response to osmotic stress [inference]

regulation of cellular response to osmotic stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of cellular response to stress [inference]

regulation of cellular response to osmotic stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of neuron differentiation [inference]

positive regulation of neuron differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

erythropoietin-mediated signaling pathway

cell surface receptor signaling pathway via STAT

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of transmembrane transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic ion transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of myeloid cell apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of erythrocyte apoptotic process

regulation of erythrocyte apoptotic process [inference]

negative regulation of erythrocyte apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of erythrocyte apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of erythrocyte apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of neuron differentiation [inference]

positive regulation of neuron differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport [inference]

negative regulation of calcium ion transmembrane transport [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of erythrocyte apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cellular localization [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

regulation of cellular response to stress [inference]

regulation of cellular response to osmotic stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to osmotic stress [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of biological quality [inference]

regulation of calcium ion transport into cytosol [inference]

negative regulation of calcium ion transport into cytosol

negative regulation of cytosolic calcium ion concentration [inference]

negative regulation of calcium ion transport into cytosol

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
extracellular region	IDA	PMID PMID
extracellular region	IEA	GO_REF GO_REF GO_REF
obsolete extracellular space
cell surface	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytokine activity	IDA	PMID PMID
cytokine activity	IBA	GO_REF
erythropoietin receptor binding	IMP	PMID
erythropoietin receptor binding	IBA	GO_REF
erythropoietin receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

erythropoietin receptor binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
51	N-linked (GlcNAc...) asparagine	10764840 11805077 2550193 2813359 3179269 32578997 3949763 7781780 8460945 8477709	G25392ZR G48109OV G91152KU G16208YZ G49446SO G62619LG G82410AF G84390MS G27844UM G28103WK G57581QG G74859XI G22721QX G13282WA G40027VO G47279LF G48488CO G90784AP G96719MC G98259QP G13165FV G69834CE G94531EZ G18639PA G83108TD G16873YG G72886NH G39643OJ G39952PY G39595FH G50489VC G56516KW G68892PJ G86696LV G86753CK G90789YQ G92574YO G67506FN G60984DZ G94309NZ G10148VG G14199EY G62461SM G58598BO G02311IE G17155VX G40194MN G64394MX G83295QG G19603RR G56811US G94974XB G15169WU G91413ZX G57888GL G12436UO G45116BB G88976TU G34617SM G68209WQ G01450UB G10228OD G11629QQ G16529MG G62765SF G80537QW G91905FJ G96503EZ G45883VE G75520NV G68796US G25379SA G27290LL G14796IU G63889NK G67610NV G90093AU G29501UT G54639VI G81263BG G97428EW G06330RB G52122ZD G18938DW G08146BT G17689DH G22310AV G33284WZ G70375MX G61962FK G48414YA G83676GD G81107PN G89098OM G00551JZ G45359RY G72797UR G86357DX G31838XA G70822IO G30460NZ G45495MK G53752TA G84452RH G10773YW G29857RC G79809MM G20218ZS G91636VS G00249IY G44215PV G14994KB G43761WH G79568CQ G03382KH G50888WV G23863VK G78059CC G88696CU G23869AA G36191CD G46687AB G51057KO G92709EO G02561FC G81295CK G93180LE G49874UX G53492UE G09176OA G29880MM G50707YR G90448RI G35364KM G94854LT	UniProt GlyGen GlyConnect
65	N-linked (GlcNAc...) asparagine	10764840 11805077 2550193 2813359 3179269 32578997 3949763 8460945 8477709	G25392ZR G48109OV G91152KU G16208YZ G49446SO G62619LG G82410AF G84390MS G27844UM G28103WK G57581QG G74859XI G22721QX G13282WA G40027VO G47279LF G48488CO G90784AP G96719MC G98259QP G05813WO G13165FV G69834CE G94531EZ G18639PA G83108TD G42459UQ G16873YG G72886NH G39643OJ G39952PY G39595FH G50489VC G56516KW G68892PJ G86696LV G86753CK G90789YQ G92574YO G67506FN G31665QC G78166NF G12793SR G83213GG G10148VG G14199EY G62461SM G58598BO G02311IE G17155VX G40194MN G64394MX G83295QG G19603RR G56811US G94974XB G15169WU G91413ZX G31153XO G93656SY G57888GL G12436UO G34617SM G68209WQ G01450UB G10228OD G11629QQ G16529MG G62765SF G80537QW G91905FJ G96503EZ G45883VE G75520NV G52527GH G63889NK G67610NV G81263BG G18938DW G17689DH G22310AV G33284WZ G52782YT G66163OV G83676GD G81107PN G00551JZ G45359RY G86357DX G72667IM G30460NZ G45495MK G53752TA G84452RH G10773YW G29857RC G79809MM G20218ZS G60723SV G00249IY G44215PV G43761WH G50888WV G78059CC G88696CU G36191CD G51057KO G55383ZG G92709EO G02561FC G93180LE G09176OA G29880MM G90448RI	UniProt GlyGen GlyConnect
110	N-linked (GlcNAc...) asparagine	10764840 11805077 22678432 2550193 2813359 3179269 32578997 3949763 8460945 8477709	G25392ZR G48109OV G71549MK G91152KU G11528MV G26777RD G16208YZ G49446SO G62619LG G82410AF G84390MS G27844UM G28103WK G57581QG G74859XI G04959WS G22721QX G13282WA G40027VO G47279LF G48488CO G90784AP G96719MC G98259QP G13165FV G69834CE G94531EZ G18639PA G83108TD G23165GD G16873YG G72886NH G39643OJ G39952PY G39595FH G50489VC G56516KW G68892PJ G86696LV G86753CK G90789YQ G92574YO G67506FN G31665QC G78166NF G10148VG G14199EY G58598BO G02311IE G17155VX G40194MN G64394MX G83295QG G19603RR G56811US G94974XB G15169WU G84331QL G91413ZX G57888GL G12436UO G47518TP G45116BB G88976TU G34617SM G68209WQ G00553AN G01450UB G10228OD G11629QQ G16529MG G62765SF G80537QW G91905FJ G96503EZ G45883VE G75520NV G31596VW G63889NK G67610NV G90093AU G57248BB G81263BG G18938DW G17689DH G22310AV G33284WZ G81107PN G00551JZ G45359RY G72797UR G86357DX G30460NZ G45495MK G53752TA G84452RH G29857RC G79809MM G20218ZS G43761WH G50888WV G78059CC G88696CU G36191CD G51057KO G92709EO G02561FC G09176OA	UniProt GlyGen GlyConnect
153	O-linked (GalNAc...) serine	10764840 11805077 22678432 2550193 2813359 3179269 32578997 3949763 8460945 8477709	G27945LI G01614ZM G81006GJ G49644CL G48809BS G60554YG G47967RK G47190LU G56682BC G74722FL G46831QF G19399OS G47318KU G71838YU G00031MO G29931IJ G57321FI	UniProt GlyGen GlyConnect
unknown		11805077 1443598 1907570 2124546 2550193 2813359 3179269 3346214 7527189 7737204 8054720 8460945 8477709 8981093	G25392ZR G48109OV G59742GY G91152KU G16208YZ G49446SO G62619LG G82410AF G84390MS G31380TD G58039UH G75154UG G27844UM G57581QG G74859XI G13282WA G26775OX G29097SS G40027VO G47279LF G48488CO G90784AP G96719MC G98259QP G05813WO G88027AL G69834CE G94531EZ G09576QH G16873YG G72886NH G14389GM G39595FH G50489VC G56516KW G68892PJ G86696LV G86753CK G92574YO G23305TF G51562OR G70894RY G19972YZ G84756CG G02311IE G17155VX G40194MN G57789QC G64394MX G98568VG G94974XB G15169WU G45209NR G91413ZX G12436UO G31544HA G31991IV G40428GO G77149EE G14950CY G77582RK G10228OD G11629QQ G16529MG G62765SF G80537QW G91905FJ G96503EZ G07410AW G16679DU G63889NK G90093AU G18938DW G47012YE G17689DH G22310AV G28948UC G45359RY G72797UR G86357DX G30460NZ G53752TA G84452RH G20425TQ G29857RC G79809MM G13441ZL G53322JT G23863VK G78059CC G36191CD G50045TK G01614ZM G81006GJ G56682BC G65562ZE G74722FL G19399OS G36123IU G00031MO G29931IJ G57321FI	GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Erythropoietin activates Phosphoinositide-3-kinase (PI3K)	Homo sapiens
Erythropoietin activates Phospholipase C gamma (PLCG)	Homo sapiens
Erythropoietin activates RAS	Homo sapiens
Erythropoietin activates STAT5	Homo sapiens
Regulation of gene expression by Hypoxia-inducible Factor	Homo sapiens
Signaling by Erythropoietin	Homo sapiens

Disease

Displaying entries **1 - 10** of 19 in total

1

2

Next ›

Last »
DO ID	Disease Name	Source
DOID:11713	diabetic angiopathy	Alliance of Genome Resources
DOID:6432	pulmonary hypertension	Alliance of Genome Resources
DOID:10652	Alzheimer's disease	Alliance of Genome Resources
DOID:6000	congestive heart failure	Alliance of Genome Resources
DOID:3021	acute kidney failure	Alliance of Genome Resources
DOID:8947	diabetic retinopathy	Alliance of Genome Resources
DOID:13268	porphyria	Alliance of Genome Resources
DOID:1289	neurodegenerative disease	Alliance of Genome Resources
DOID:3891	placental insufficiency	Alliance of Genome Resources
DOID:1184	nephrotic syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements